SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418536|ref|YP_145854.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418536|ref|YP_145854.1|
Domain Number 1 Region: 113-325
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.92e-48
Family Extended AAA-ATPase domain 0.00000516
Further Details:      
 
Domain Number 2 Region: 344-449
Classification Level Classification E-value
Superfamily TrpR-like 1.67e-38
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56418536|ref|YP_145854.1|
Sequence length 450
Comment chromosome replication initiator DnaA [Geobacillus kaustophilus HTA426]
Sequence
MENIHDLWDRVLAEIEQKISKPSFETWLKSTKAHSLRGDTLVIVAPNEFARDWLDSRYSH
LIAETIYTITGEELAVKFIIPPNQDDEELEFQSSKKKQRKPYEETNDFPQSMLNPKYTFD
TFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPSAKVV
YLSSEKFTNEFINAIRDNRPDDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHE
ESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGFDIPN
EVMLYIANQIDSNIRELEGALIRVVAYSSLINKEITADLAAEALKDIIPSAKPKVITIQD
IQRVVGQHFNIKMEDFKAKKRTKSVAFPRQIAMYLSRELTDCSLPKIGDEFGGRDHTTVI
HAHEKISKLLQTDTQLQRHIQEIQEKLKQL
Download sequence
Identical sequences A0A063Z003 A0A098KZS3 A0A0K2H8M4 A0A1C3D785 A0A1V9C2M2 A0A2H5KID8 L7ZM60 Q5L3Z2 T0P3Y3 U2Y2H2 V6VEN6
gi|297528377|ref|YP_003669652.1| 235909.GK0001 WP_011229517.1.100150 WP_011229517.1.17728 WP_011229517.1.19233 WP_011229517.1.20723 WP_011229517.1.2219 WP_011229517.1.22479 WP_011229517.1.25743 WP_011229517.1.38928 WP_011229517.1.45808 WP_011229517.1.46340 WP_011229517.1.59104 WP_011229517.1.60903 WP_011229517.1.6497 WP_011229517.1.70239 WP_011229517.1.78869 WP_011229517.1.90668 WP_011229517.1.91533 WP_011229517.1.92435 WP_011229517.1.93593 gi|56418536|ref|YP_145854.1| gi|448236311|ref|YP_007400369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]