SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418552|ref|YP_145870.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418552|ref|YP_145870.1|
Domain Number 1 Region: 31-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.97e-60
Family Extended AAA-ATPase domain 0.00000497
Further Details:      
 
Domain Number 2 Region: 247-359
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 2.75e-27
Family MgsA/YrvN C-terminal domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56418552|ref|YP_145870.1|
Sequence length 559
Comment DNA polymerase III subunits gamma and tau [Geobacillus kaustophilus HTA426]
Sequence
MAYQALYRVFRPQRFADMVGQEHVTKTLQSALLQHKISHAYLFSGPRGTGKTSAAKIFAK
AVNCEQAPAAEPCNECPACLGITNGTVPDVLEIDAASNNRVDEIRDIREKVKFAPTSARY
KVYIIDEVHMLSIGAFNALLKTLEEPPKHVIFILATTEPHKIPTTIISRCQRFDFRRIPL
PAIVSRLKYVASAQGVEASDEALSAIARAADGGMRDALSLLDQAISFSDGKLRLDDVLAM
TGAASFAALSSFIEAIHRKDTAAVLQQLETMMAQGKDPHRLVEDLILYYRDLLLYKTAPY
VEGAIQIAVVDEAFTSLSEMIPVSNLYEAIELLNKSQQEMKWTNHPRLLLEVALVKLCHP
SAAAPSLSASELEPLIKRIETLEAELRRLKEQPPAPPSTAAPVKKLSKPMKTGGYKAPVG
RIYELLKQATHEDLALVKGCWADVLDTLKRQHKVSHAALLQESEPVAASASAFVLKFKYE
IHCKMATDPTSSVKENVEAILFELTNRRFEMVAIPEGEWGKIREEFIRNKDAMVEKSEED
PLIAEAKRLFGEELIEIKE
Download sequence
Identical sequences A0A063Z1D7 A0A1D7NFZ3 Q5L3X6
WP_011229533.1.19233 WP_011229533.1.2219 WP_011229533.1.6497 235909.GK0017 gi|56418552|ref|YP_145870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]