SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418583|ref|YP_145901.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418583|ref|YP_145901.1|
Domain Number 1 Region: 15-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.25e-91
Family Tandem AAA-ATPase domain 0.00041
Further Details:      
 
Domain Number 2 Region: 543-803
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.72e-64
Family Tandem AAA-ATPase domain 0.000000556
Further Details:      
 
Domain Number 3 Region: 802-1008
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.76e-49
Family Tandem AAA-ATPase domain 0.00000219
Further Details:      
 
Domain Number 4 Region: 1015-1168
Classification Level Classification E-value
Superfamily TRCF domain-like 2.75e-37
Family TRCF domain 0.0009
Further Details:      
 
Domain Number 5 Region: 490-568
Classification Level Classification E-value
Superfamily CarD-like 6.54e-27
Family CarD-like 0.00046
Further Details:      
 
Domain Number 6 Region: 377-490
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.12e-26
Family Tandem AAA-ATPase domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56418583|ref|YP_145901.1|
Sequence length 1177
Comment transcription-repair coupling factor [Geobacillus kaustophilus HTA426]
Sequence
MLSLHRYLAENQDVRTIIEGLHVRLKEQLVAGLSGSARSVFISTLYKETGRPLLVVSHNL
FQAQKMYDDLVSLLGPEDVFLYSVNEVIAAEMAVASPELKAQRLEIMNHWVQGGKGVVVC
PVAGLRRLLPPPSLWKQYLFTFSVGQEFDVERCKQKFVQMGYKRVGTVSAPGEFSVRGGI
IDIYPLTAELPYRIELFDTEIESIRTFTPDDQRSQGQIERIMIGPADEIILDGETRRRGI
ERIEAGLASSLETMKDEAAKQRMYEHIHAELEQLREGQEIEQQYKYMSLFYEKVASLLDY
LPEDGVLLMDEMSRLQEAAERLDREEAEWYTSLLDGGKMIHGVPLSHSFSELLQKHRFQR
VYLSLFLRHVPYAHPQNVVNITCKQMQNFHGQMALLQSEVERWTKANYAVVFLAPNAERV
KKLQSLLQDYEIDALPLARDAALLHGKCQLLEGDLNTGFELPLQKIAVITEEELFKKRVK
RPVRRQKLSNAERIKSYAELQVGDYVVHVNHGIGKYLGIETLEINGVHKDYIHIQYQGGD
TLYVPVDQIDQVQKYVGSEGKEPKIYKLGGSEWKKVKRKVESSVQDIAEDLIKLYAEREA
SKGYAFSPDTEMQREFEAAFPYQETEDQLRSIEEIKRDMESDKPMDRLLCGDVGYGKTEV
ALRAAFKAIMDGKQVAFLVPTTILAQQHYETVRERFQGFPIKVGLLNRFRTKKQQAETIK
GLKDGTIDMVIGTHRLLSKDVEFKDLGLLIIDEEQRFGVAHKEKIKQLKANIDVLTLTAT
PIPRTLHMSMIGVRDLSIIETPPENRFPVQTYVMEYTPELVKEAIERELARDGQVFFLYN
HIEDIDLKAEEIAQLVPEARVTYVHGRMSETELESTILAFLEGQYDVLVTTTIIETGIDI
PNVNTLIVYDADRMGLSQLYQLRGRVGRSNRVAYAYFTYRKDKVLNEAAEKRLQAIKEFT
ELGSGFKIAMRDLSIRGAGNILGAEQHGFIDSVGFDLYSQMLKEAIEKRRGIKREDEQPD
VVIDVEVDAYIPSTYIADELQKIEMYKRFKAVETLEDIEELREEMVDRFGDYPDEVAYLF
QIAELKVLAKQLGVESMKQHKQQIDILFTEPASKTVEIQRLSDIGRRHGRLFGFGMDGAK
LKIVLYIKEMKPHEWLMILEETLRRLSGVEKEKSVTA
Download sequence
Identical sequences Q5L3U5
gi|56418583|ref|YP_145901.1| WP_011229563.1.2219 235909.GK0048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]