SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418613|ref|YP_145931.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418613|ref|YP_145931.1|
Domain Number 1 Region: 486-802
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-86
Family Extended AAA-ATPase domain 0.0000000081
Further Details:      
 
Domain Number 2 Region: 160-464
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.21e-79
Family Extended AAA-ATPase domain 0.0000000199
Further Details:      
 
Domain Number 3 Region: 5-145
Classification Level Classification E-value
Superfamily Double Clp-N motif 2.55e-33
Family Double Clp-N motif 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56418613|ref|YP_145931.1|
Sequence length 810
Comment ATP-dependent Clp protease ATPase [Geobacillus kaustophilus HTA426]
Sequence
MMFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEGIAAKALMALGLGPDKI
QKEVESLIGRGSEVSHTIHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVA
ARVLNNLGVSLNKARQQVLQLLGSNESMSGHGGGASHVSTPTLDSLARDLTAIAREGRLD
PVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIVNNEVPETLRDKRVM
TLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDELHTLIGAGGAEGAIDASNIL
KPALARGELQCIGATTLDEYRKYIEKDAALERRFQPIYVDEPTVEESIQILKGLRDRYEA
HHRVSISDEAIVQAVKLSDRYITDRFLPDKAIDLIDEACSKVRLRSFTAPPKLKELEQKL
EEVRKEKDAAVQSQEFEKAASLRDMEQRLREELEETKRAWKEKQGQENLEVTVEDIAAVV
SSWTGIPVSKLAETETERLLKLEEILHSRVVGQDEAVKAVAKAVRRARAGLKDPKRPIGS
FIFLGPTGVGKTELARALAEAMFGDEDALIRIDMSEYMEKHSTSRLIGSPPGYVGYEEGG
QLTEKVRRKPYSVVLLDEMEKAHPDVFNILLQVLEDGRLTDSKGRTVDFRNTIIIMTSNV
GADALKRNKYVGFNIQDGNQQYKDMKSKVMDELKKAFRPEFLNRIDEIIVFHSLEKDHLK
QIVRLMADTLVKRLKEQDIDLELTEAAIEKIAAEGFDPEYGARPLRRALQKHVEDRLSEE
LLKGTIAKGQKVVVDVKDGEFVVLSKQAVV
Download sequence
Identical sequences A0A063YZG5 A0A098KY88 A0A0K2H8U6 A0A142D4V6 A0A1D7N7I4 A0A1Q5T269 A0A1V4P8P2 A0A1V9C534 A0A2H5KI48 G8N0X5 L7ZSL2 Q5L436 T0NUQ1 V6VHR4
gi|375006890|ref|YP_004980520.1| 235909.GK0078 gi|56418613|ref|YP_145931.1| WP_011229593.1.100150 WP_011229593.1.17728 WP_011229593.1.19233 WP_011229593.1.20723 WP_011229593.1.2219 WP_011229593.1.25743 WP_011229593.1.3446 WP_011229593.1.38928 WP_011229593.1.45808 WP_011229593.1.46340 WP_011229593.1.59104 WP_011229593.1.60903 WP_011229593.1.6497 WP_011229593.1.70239 WP_011229593.1.77642 WP_011229593.1.78869 WP_011229593.1.8599 WP_011229593.1.90668 WP_011229593.1.9165 WP_011229593.1.93593 gi|448236388|ref|YP_007400446.1| gi|297528454|ref|YP_003669729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]