SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418638|ref|YP_145956.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418638|ref|YP_145956.1|
Domain Number 1 Region: 6-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-114
Family G proteins 0.0000000073
Further Details:      
 
Domain Number 2 Region: 477-597
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-45
Family Translational machinery components 0.00000444
Further Details:      
 
Domain Number 3 Region: 263-402
Classification Level Classification E-value
Superfamily Translation proteins 1.67e-37
Family Elongation factors 0.0000318
Further Details:      
 
Domain Number 4 Region: 598-688
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.87e-32
Family EF-G/eEF-2 domains III and V 0.000034
Further Details:      
 
Domain Number 5 Region: 400-478
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.55e-27
Family EF-G/eEF-2 domains III and V 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56418638|ref|YP_145956.1|
Sequence length 692
Comment elongation factor G [Geobacillus kaustophilus HTA426]
Sequence
MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHEGAATMDWMEQEQERG
ITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAITVLDAQSGVEPQTETVW
RQATTYGVPRIVFVNKMDKIGADFLYSVKTLHDRLQANAHPVQLPIGAEDQFSGIIDLVE
MCAYHYHDELGKNIERIDIPEEYRDMAEEYHNKLIEAVAELDEELMMKYLEGEEITTEEL
KAAIRKATISVEFFPVFCGSAFKNKGVQLLLDGVVDYLPSPVDIPAIRGVVPDTEEEVTR
EASDDAPFAALAFKIMTDPYVGKLTFIRVYSGTLDSGSYVMNTTKGKRERIGRLLQMHAN
HRQEISKVYAGDIAAAVGLKDTTTGDTLCDEKHPVILESMQFPEPVISVAIEPKSKADQD
KMSQALQKLQEEDPTFRAHTDPETGQTIISGMGELHLDIIVDRMRREFKVEANVGAPQVA
YRETFRKSAQVEGKFIRQSGGRGQYGHVWIEFSPNERGKGFEFENAIVGGVVPKEYVPAV
QAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSSEMAFKIAASLALKNAATKCDPVLL
EPIMKVEVVIPEEYLGDIMGDITSRRGRIEGMEARGNAQVVRAMVPMAEMFGYATSLRSN
TQGRGTFSMVFDHYEEVPKNIADEIIKKNKGE
Download sequence
Identical sequences Q5L400
235909.GK0103 gi|56418638|ref|YP_145956.1| WP_011229618.1.2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]