SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418662|ref|YP_145980.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418662|ref|YP_145980.1|
Domain Number 1 Region: 1-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-45
Family Nucleotide and nucleoside kinases 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56418662|ref|YP_145980.1|
Sequence length 217
Comment adenylate kinase [Geobacillus kaustophilus HTA426]
Sequence
MNLVLMGLPGAGKGTQAGKIVEAYGIPHISTGDMFRAAIKEGTPLGLQAKQYMDRGDLVP
DEVTIGIVRERLSKEDCQHGFLLDGFPRTVAQAEALETLLSEIGRKLDYVIHIDVRQEVL
MERLTGRRICRNCGATYHLVFHPPAKPGVCDKCGGDLYQRPDDNEATVANRLEVNMKQMK
PLLDFYEQKGYLRHINGEQEMEKVFADICEVLGGLAR
Download sequence
Identical sequences Q5L3R8
gi|56418662|ref|YP_145980.1| WP_011229640.1.2219 235909.GK0127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]