SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418678|ref|YP_145996.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418678|ref|YP_145996.1|
Domain Number 1 Region: 88-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.46e-47
Family Nitrogenase iron protein-like 0.0035
Further Details:      
 
Domain Number 2 Region: 1-71
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 0.0000036
Family PaaD-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56418678|ref|YP_145996.1|
Sequence length 338
Comment chromosome partitioning ATPase [Geobacillus kaustophilus HTA426]
Sequence
MLTETEVRAILEKMKDPFLNKTFKETNAIQEIKIKEEKNHVSVKIALAKTGTPEQLRVQT
AIVEQLKDAGAATVGLRFAELPRDVVEKYSENKQKTTYIAIASGKGGVGKSTVSVNLAVA
LARLGKKVGLIDADIYGFSVPDMMGITERPTVRGDKIIPVERFGVKVISMAFFVEDNAPV
IWRGPMLGKMLNNFFKEVEWGDLDYLLLDLPPGTGDVALDVHTLLPSCKEIIVTTPHPTA
AFVAARAGAMALRTEHEIIGVIENMSYYESRKTGEREYVFGKGGGEKLAKELQTELLGQL
PLQQPDWNDDDFAPSVYAEDHPIGKIYMDIARKIVAKY
Download sequence
Identical sequences A0A063YXT2 A0A0E0T7J7 A0A0K2H9Y2 A0A142D544 A0A1C3D7G6 A0A1V9BXS8 A0A2H5KHY8 G8N143 L7ZSS1 Q5L3Q2 T0Q7Z4 V6VGL2
gi|375006958|ref|YP_004980588.1| gi|297528519|ref|YP_003669794.1| gi|261417644|ref|YP_003251326.1| 235909.GK0143 544556.GYMC61_0144 gi|319765302|ref|YP_004130803.1| gi|448236453|ref|YP_007400511.1| gi|56418678|ref|YP_145996.1| WP_011229655.1.100150 WP_011229655.1.17728 WP_011229655.1.19233 WP_011229655.1.20723 WP_011229655.1.2219 WP_011229655.1.22479 WP_011229655.1.25743 WP_011229655.1.38928 WP_011229655.1.46340 WP_011229655.1.50933 WP_011229655.1.59104 WP_011229655.1.60903 WP_011229655.1.6497 WP_011229655.1.70239 WP_011229655.1.78869 WP_011229655.1.80994 WP_011229655.1.8599 WP_011229655.1.90668 WP_011229655.1.91533 WP_011229655.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]