SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56418714|ref|YP_146032.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418714|ref|YP_146032.1|
Domain Number 1 Region: 18-198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.06e-37
Family Phosphoribulokinase/pantothenate kinase 0.000000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56418714|ref|YP_146032.1|
Sequence length 201
Comment uridine kinase [Geobacillus kaustophilus HTA426]
Sequence
MELRDRIDFLCKTILAIKTAGRLVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFHMDD
HIVERAKRYHTGNEEWFEYYYLQWDVEWLTHQLFRQLKASHQLTLPFYDHETDTHSKRTV
YLSDSDMIMIEGVFLQRKEWRPFFDFVVYLDCPREIRFARENDQVKQNIQKFINRYWKAE
DYYLETEEPIKRADVVFDMTS
Download sequence
Identical sequences A0A1V9BS44 P84134 Q5L3L6 T0NLU1 V6VG87
1rz3A 235909.GK0179 APC36099 1rz3_A WP_011229690.1.100150 WP_011229690.1.2219 WP_011229690.1.25743 WP_011229690.1.38513 WP_011229690.1.38928 WP_011229690.1.45808 WP_011229690.1.59104 WP_011229690.1.59290 WP_011229690.1.70239 WP_011229690.1.77642 WP_011229690.1.90668 gi|56418714|ref|YP_146032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]