SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418729|ref|YP_146047.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418729|ref|YP_146047.1|
Domain Number 1 Region: 4-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.31e-62
Family ABC transporter ATPase domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56418729|ref|YP_146047.1|
Sequence length 263
Comment ferrichrome ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MVRLYAEELTVRYDDRTIFERLSVRIPDRQITAIIGPNGCGKSTLLKTLTRIISPQSGAV
ILDGRAISQQPTKELAKKIAILPQTPEATSGLTVAELVSYGRFPYQRGWGRLTKQDYEAI
DWALAVTKTADLKHRPVDALSGGQRQRVWIAMALAQETDIIFLDEPTTYLDIAHQLEVLE
LLERLNKEEGRTIVMVLHDINQAARFSDYVIAMKAGTIVKAGPSEDVICRDVLRDVFGID
ADIGRDPRTNKPICFTYQLLREA
Download sequence
Identical sequences A0A1C3D6H8 A0A1V9BRY9 A0A2H5KHW2 Q5L3K1 T0NLS8
gi|297528546|ref|YP_003669821.1| 235909.GK0194 WP_011229704.1.100150 WP_011229704.1.20723 WP_011229704.1.2219 WP_011229704.1.22479 WP_011229704.1.45808 WP_011229704.1.46340 WP_011229704.1.60903 WP_011229704.1.6497 WP_011229704.1.70239 WP_011229704.1.8599 WP_011229704.1.92435 gi|56418729|ref|YP_146047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]