SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418742|ref|YP_146060.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418742|ref|YP_146060.1|
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000451
Family ABC transporter ATPase domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56418742|ref|YP_146060.1|
Sequence length 135
Comment hypothetical protein GK0207, partial [Geobacillus kaustophilus HTA426]
Sequence
MKKLNEMGCTIIYTSHYMEEVEEICTRIAIIDHGKIIAEGTKEQLEAIITDTKDIWLEIR
GMDRLNKQHLQDIPGVKAVQCEENMIKISSDISVNNLNEIVQCLINDGVEIRSLEDKSPN
LETVFLALTGRNLRD
Download sequence
Identical sequences A0A063YZD2 Q5L3I8 T0Q825
gi|56418742|ref|YP_146060.1| 235909.GK0207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]