SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418761|ref|YP_146079.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418761|ref|YP_146079.1|
Domain Number 1 Region: 71-356
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.56e-76
Family Tandem AAA-ATPase domain 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56418761|ref|YP_146079.1|
Sequence length 467
Comment ATP-dependent RNA helicase [Geobacillus kaustophilus HTA426]
Sequence
MTTFQELGLSQEVMKAIERMGFEETTPIQAKTIPLSLQNKDVIGQAQTGTGKTAAFGIPI
VEKVNVKNSAVQALVVAPTRELAIQVSEELYKIGAVKRVRVLPIYGGQDIERQIRALKKH
PHVIVGTPGRIIDHINRGTLRLEHVHTVVLDEADEMLNMGFIEDIEAILSHVPAERQTLL
FSATMPDPIRRIAERFMNEPELVKVKAKEMTVPNIQQYYLEVHEKKKFDILTRLLDIQAP
ELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLSQAKRLSVLRKFKEGAIEILVATDVA
ARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKTGVAMTFVTPREIGQLHHIERTTK
RKMERMKPPTLDEALEGQQRIAIEKLLNVVETENLSFYKRAAEELLEEHDSVTIVAACLK
MLTREPDTTPVQLTEEPPLAVKREKKRGGRPDGSARSRTKKRRITAH
Download sequence
Identical sequences A0A1V9CK01 Q5L3G9 S7UDI2
WP_011229736.1.2219 WP_011229736.1.92435 gi|56418761|ref|YP_146079.1| 235909.GK0226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]