SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418775|ref|YP_146093.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418775|ref|YP_146093.1|
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.71e-48
Family ABC transporter ATPase domain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 319-535
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-47
Family ABC transporter ATPase domain-like 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|56418775|ref|YP_146093.1|
Domain Number - Region: 583-630
Classification Level Classification E-value
Superfamily Release factor 0.018
Family Release factor 0.016
Further Details:      
 
Domain Number - Region: 238-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0929
Family G proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56418775|ref|YP_146093.1|
Sequence length 641
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MIILQVHGLTKYFGADLILSNIKLEIQSHDRIALVGRNGAGKSTLLKIIAGELSFDSGKI
IKPNHIKIGYLAQNSGLDSPRSIWDEMLEVFTPLLGLEKQLAELSMQLGDPDVLADPARY
EKTLKTYDELQEQYKEQGGYQYEADIRSVLHGLQFSSYDYKTTPISSLSGGQRTRLALGK
LLLSKPDLLILDEPTNHLDLETLSWLEQYLQAYPGAVLVVSHDRYFLDKIVTDVYELSNA
TLKHYAGNYSRYLELRAEQYEQELRRYEKQQEEIARLQDFIQRNIARASTAKRAQSRRKQ
LEKIERLERPVGDEKSASFSFSIDRPSGYEVLTAEDIAVGYGDGAPIIRQISFRITRGES
VALVGPNGIGKSTLLKAIARKLPIQTGELRYGANVQIGYYDQDQADLSSNKRVLDELWDA
YPEKTEKEIRTVLGNFLFSGDDVLKPVSALSGGEKARLSLAKLMLQKANVLLLDEPTNHL
DLDSKEVLEQALIDYPGTILFVSHDRYFINRIATKVFELSSGGLTEYLGDYDYYIAKKEE
MRELALLNVRPTETASDSAKTTYEQEKEEKKRRRQRQRRLDEIEAEIATLEAQIAEIEQQ
LCDPSVYGDYETMQRLTQENDERKQRVEMLLAEWEQLYTSL
Download sequence
Identical sequences Q5L3F5
gi|56418775|ref|YP_146093.1| WP_011229749.1.2219 235909.GK0240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]