SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418810|ref|YP_146128.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418810|ref|YP_146128.1|
Domain Number 1 Region: 1-647
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.61e-196
Family Tandem AAA-ATPase domain 8.82e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56418810|ref|YP_146128.1|
Sequence length 724
Comment ATP-dependent DNA helicase [Geobacillus kaustophilus HTA426]
Sequence
MNFLSEKLLAHLNKEQQEAVKTTEGPLLIMAGAGSGKTRVLTHRIAYLMAEKQVAPWNIL
AITFTNKAAREMKERVQALLGGAAEDVWISTFHSMCVRMLRRDIDRIGINRNFSILDPTD
QLSVIKAILKDKNIDPKKFEPRTILATISGAKNDLLTPEQFAKRASTYYEKIVGDVYQEY
QQRLLRNHSLDFDDLIMTTIHLFDRVPDVLQYYQYKFQYIHIDEYQDTNRAQYTLVKKLA
DRFQNICAVGDADQSIYRWRGADIRNILSFERDYPNAKVILLEQNYRSTKRILQAANEVI
AHNVNRKPKRLWTENPEGKPIVYYEAMNEVDEAQFVARRIQEAVESGERRYRDFAVLYRT
NAQSRVIEEMFLKANIPYQIVGGLKFYDRKEIKDILAYLRVIANPDDDLSLLRIINVPKR
GIGASTIDKLVRYAAEHELSLFEALGELEMIGFSAKTAGALAAFRGQLEQWTQLQEYVPV
TELVEEVLDQSGYREMLKAERTIEAQSRLENLDEFLSVTKHFENVSDDKSLVAFLTDLAL
ISDLDELNGTDQAAEGDAVVFMTLHAAKGLEFPVVFLIGMEEGIFPHLRSLENEDEMEEE
RRLAYVGITRAEEELVLTNAQMRTLFGNIQMNRPSRFLDEIPAHLLETVSRGKPSVSRSA
SARLQAGGAIRVWKVGDRANHRKWGIGTVVSVRGEGDDQELDIAFPSPIGIKRLLAKFAP
IEKV
Download sequence
Identical sequences A0A1C3D5Y8 A0A2H5KMC5 Q5L3C0
WP_011229784.1.17728 WP_011229784.1.2219 WP_011229784.1.22479 WP_011229784.1.25743 WP_011229784.1.90668 235909.GK0275 gi|56418810|ref|YP_146128.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]