SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418849|ref|YP_146167.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418849|ref|YP_146167.1|
Domain Number 1 Region: 1-240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.19e-83
Family ABC transporter ATPase domain-like 0.0000026
Further Details:      
 
Domain Number 2 Region: 251-369
Classification Level Classification E-value
Superfamily CBS-domain pair 1.26e-26
Family CBS-domain pair 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56418849|ref|YP_146167.1|
Sequence length 375
Comment glycine betaine/carnitine/choline ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MIRFENVTKQYEDGFVALKNINLEIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVY
IDGQDISQLDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHAYEKRVDELLE
LVGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEPFSALDPISREQLQDDIV
RLQEEIHKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQMLRRPANSFVREFIGED
RLRIRHTAVPTAEDLMSADVATISPRRGLAEAFRLMKAKKVDSLVVVDKKQVFLGIVTLK
QIEQRYQEEHLLVADIADYDVTTLSKEADVTNVAALFQDPDVRIIPVLDGDRLVGGITRS
SMMRALAEWTFQQHA
Download sequence
Identical sequences A0A098L7G1 A0A0J0V9W5 A0A1D7N804 A0A1V9C354 A0A2H5KHJ1 G8N3N9 Q5L381 T0Q3F2 U2X7Y4 V6VGW6
WP_011229819.1.100150 WP_011229819.1.2219 WP_011229819.1.25743 WP_011229819.1.38928 WP_011229819.1.45808 WP_011229819.1.57889 WP_011229819.1.60903 WP_011229819.1.6497 WP_011229819.1.65208 WP_011229819.1.70239 WP_011229819.1.78869 WP_011229819.1.8599 WP_011229819.1.86012 WP_011229819.1.90668 WP_011229819.1.91533 WP_011229819.1.93593 gi|56418849|ref|YP_146167.1| gi|375007194|ref|YP_004980826.1| 235909.GK0314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]