SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56418949|ref|YP_146267.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56418949|ref|YP_146267.1|
Domain Number 1 Region: 22-195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.9e-41
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56418949|ref|YP_146267.1|
Sequence length 203
Comment adenylylsulfate kinase [Geobacillus kaustophilus HTA426]
Sequence
MSTNIVWHHTSVTKEDRRKRNGHHSAILWFTGLSGSGKSTVANAVSRRLFELGIQNYVLD
GDNIRHGLNKDLGFSAADRTENIRRIGEVAKLFVDSGQFVLTAFISPFAEDRALVRRLVE
EDEFIEIYVNCPLEECEKRDPKGLYQKARRGEIREFTGIDSPYEAPEAPELTIETHRYSV
DECAEQVLAYLRERGMIPAAKTD
Download sequence
Identical sequences A0A098L6P3 A0A0D8BUV0 A0A1D7N8A5 A0A1V9BRE8 A0A2H5KH70 G8N4H3 Q5L2Y1 T0NNB5 U2X7H7 V6VFJ9
WP_011229918.1.100150 WP_011229918.1.13089 WP_011229918.1.2219 WP_011229918.1.25743 WP_011229918.1.38260 WP_011229918.1.45808 WP_011229918.1.60903 WP_011229918.1.6497 WP_011229918.1.70239 WP_011229918.1.78869 WP_011229918.1.8599 WP_011229918.1.90668 WP_011229918.1.91533 WP_011229918.1.93593 235909.GK0414 gi|375007316|ref|YP_004980948.1| gi|56418949|ref|YP_146267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]