SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419007|ref|YP_146325.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419007|ref|YP_146325.1|
Domain Number 1 Region: 32-250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.39e-60
Family ABC transporter ATPase domain-like 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419007|ref|YP_146325.1|
Sequence length 334
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MNAIEVEHLRKEFKVHKSRSGLVGAFRDLWTRRYTLVRAVDDISFAVKQGEIVGYIGENG
AGKSTTIKMLTGILTPTSGRIVVNGMNPHKEREKFVRTIGVVFGQRSQLWWDIAVQESFR
LLKKVYRVSDEQYRRHMAEVIDMLEIGPLLDKPVRKLSLGQRMRCELAAALIHNPPLLFL
DEPTIGLDVLVKLNIRQFLKQLNERYGTTILLTTHDMSDIEALCERVIMLDEGKIIYDGS
LERLKERWGQGKRVAFTFAEAVTAAFLQQLTEGLDVVWKKGEQPNVWVSHVPSGGVPEVV
SRVAARCALNDIHIHEVPTEEIIRNIYEEGAVHG
Download sequence
Identical sequences A0A063YWZ6 A0A098L6W0 A0A1C3D246 A0A1V9BVD6 A0A2H5KH04 G8N552 Q5L2S3 T0PZT9 U2WUQ8 V6VBW7
235909.GK0472 WP_011229976.1.100150 WP_011229976.1.19233 WP_011229976.1.2219 WP_011229976.1.22479 WP_011229976.1.25743 WP_011229976.1.45808 WP_011229976.1.60903 WP_011229976.1.6497 WP_011229976.1.70239 WP_011229976.1.78869 WP_011229976.1.8599 WP_011229976.1.90668 WP_011229976.1.91533 WP_011229976.1.93593 gi|375007383|ref|YP_004981015.1| gi|56419007|ref|YP_146325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]