SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419021|ref|YP_146339.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419021|ref|YP_146339.1|
Domain Number 1 Region: 68-178,231-368,405-469
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000228
Family Extended AAA-ATPase domain 0.091
Further Details:      
 
Weak hits

Sequence:  gi|56419021|ref|YP_146339.1|
Domain Number - Region: 555-624
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0147
Family HLH, helix-loop-helix DNA-binding domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419021|ref|YP_146339.1|
Sequence length 631
Comment serine protein kinase [Geobacillus kaustophilus HTA426]
Sequence
MDILQKIARYREEEEKLKWEGTFAEYLKILKEKPWVAQSAHSRVYNMIKDAGVEEVNGRK
RYKFFSQHLFGLEEALERLVEEYFHPAAKRLDVRKRILLLMGPVGGGKSTLVTLLKRGLE
EYSKTERGAVYAIKGCPMHEDPLHLIPHHLRDDFYREYGIRIEGELSPLNMMRLEKEYGG
RIEDVLVERIFFSENRRVGIGTFSPSDPKSQDIADLTGSIDFSTIAEYGSESDPRAYRFD
GELNKANRGIMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRFALISADELIIAHTNETEYR
SFIANKKNEALHSRIIVMPIPYNLRVSEEERIYEKMIRESDVADVHIAPHTLRIAAMFTI
LTRLKESKRPDVDLLKKMRLYDGEMIEGFSEVDVEELKKEHPDEGMSGIDPRYVINRISA
CIIRKGVPSINALDVLRSLKEGLDQHPSITKEDRERYLNFISLVRKEYDEIAKQEVQKAF
VYSYEESAKTLMDNYLDNVEAYCNKTKLRDPLTGEEMNPDEKLMRSIEEQIGISENAKKA
FREEILIRISAYARKGQRFDYNSHERLREAIQKKLFADLKDIVKITTSTKTPDEQQLKKI
NEVVARLIDEYGYNSTSANELLRYVGSLLNR
Download sequence
Identical sequences A0A063Z0T9 A0A098L5U6 A0A0E0T8Q1 A0A0J0VAL1 A0A0K2HA05 A0A0N0Z682 A0A142D610 A0A1C3D5L6 A0A1V4P4N9 A0A1V9BW55 A0A2H5KH05 G8N5M9 L7ZTS4 Q5L2Q9 T0NGZ0 U2X785 V6VAY4
gi|375007399|ref|YP_004981032.1| gi|448236768|ref|YP_007400826.1| APC36187 gi|297531221|ref|YP_003672496.1| gi|56419021|ref|YP_146339.1| 235909.GK0486 544556.GYMC61_1372 WP_011229990.1.100150 WP_011229990.1.17728 WP_011229990.1.19233 WP_011229990.1.20723 WP_011229990.1.2219 WP_011229990.1.22479 WP_011229990.1.25743 WP_011229990.1.3446 WP_011229990.1.38928 WP_011229990.1.45808 WP_011229990.1.46340 WP_011229990.1.50933 WP_011229990.1.57889 WP_011229990.1.59104 WP_011229990.1.60903 WP_011229990.1.6497 WP_011229990.1.65208 WP_011229990.1.70239 WP_011229990.1.78869 WP_011229990.1.80994 WP_011229990.1.8599 WP_011229990.1.86012 WP_011229990.1.90668 WP_011229990.1.91533 WP_011229990.1.9165 WP_011229990.1.92435 WP_011229990.1.93593 gi|319765633|ref|YP_004131134.1| gi|261418817|ref|YP_003252499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]