SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56419045|ref|YP_146363.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419045|ref|YP_146363.1|
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000875
Family LexA repressor, N-terminal DNA-binding domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419045|ref|YP_146363.1|
Sequence length 44
Comment hypothetical protein GK0510, partial [Geobacillus kaustophilus HTA426]
Sequence
MFYLWHHRKVLTIDELANRLNREPKAVYEKLKQLLQKGGISDAG
Download sequence
Identical sequences Q5L2N5
235909.GK0510 gi|56419045|ref|YP_146363.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]