SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419147|ref|YP_146465.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|56419147|ref|YP_146465.1|
Domain Number - Region: 446-506,608-664
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0824
Family ABC transporter transmembrane region 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56419147|ref|YP_146465.1|
Sequence length 691
Comment carbon starvation protein [Geobacillus kaustophilus HTA426]
Sequence
MKGLKSILLWGLISVLGAAAFAILALSRGESVNAMWLIVAAVCTYAVAYRFYSRFIARKV
FGLDDNRKTPAEVFNDGKDYVPTNKWVLFGHHFAAIAGAGPLVGPILAAQMGYLPGTLWI
VIGVVLGGAVQDFVILFASMRRNGKSLGEMIKEEMGPVTGFIAALGILGIMIILLAVLAL
VVVKALVGSPWGMFTIAATIPIAILMGIYMRFIRPGRVAEASLGGFVLLILSIVVGQYVA
EHPTLSAMFTLKGETIAILMIIYGFVASALPVWLLLAPRDYLSTFLKIGTIVGLALGIFV
VMPDLQMPAVTKFIDGTGPVFAGNLFPFLFITIACGAVSGFHALVSSGTTPKMIELESHA
RPIGYGAMLMESFVAVMAMVAACVLTPGAYFAINSPAAVIGTDVAQAAKVVSSWGFTVTP
DMLAQLAKDVGEQTVLSRTGGAPTLAIGMAHILSSVIGGKALMAFWYHFAILFEALFILT
TIDAGTRVGRFMIQDIMGTFYKPLGKTDSLASNLIATTLCVLAWGYFLYQGVVDPLGGIN
TLWPLFGIANQMLAGIALLFATTVLFKMGKKAYVWVTLVPTTWLLVVTLTAGYQKLFHEN
VKIGFLSHAKMFQDSLSQGKILAPATNEAQMRQIIMNDYIDATLCAIFMLVVIAMLISAL
NIWIKVLQNKHVPLKEAPYVPRDGEGAKHYA
Download sequence
Identical sequences A0A063YYB3 A0A098L7W5 A0A1C3D669 A0A1V9BZD4 A0A2H5KGU6 G8N5U8 Q5L2D3 T0NRB5 U2X7A4
gi|375007468|ref|YP_004981101.1| gi|56419147|ref|YP_146465.1| WP_011230116.1.100150 WP_011230116.1.19233 WP_011230116.1.2219 WP_011230116.1.22479 WP_011230116.1.6497 WP_011230116.1.70239 WP_011230116.1.78869 WP_011230116.1.8599 WP_011230116.1.90668 WP_011230116.1.91533 WP_011230116.1.93593 235909.GK0612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]