SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419166|ref|YP_146484.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419166|ref|YP_146484.1|
Domain Number 1 Region: 4-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-86
Family ABC transporter ATPase domain-like 0.000000103
Further Details:      
 
Domain Number 2 Region: 237-365
Classification Level Classification E-value
Superfamily MOP-like 1.36e-29
Family ABC-transporter additional domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56419166|ref|YP_146484.1|
Sequence length 370
Comment sugar ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MAELILDHIYKIYDNNVVAVKDFNLHIQDKEFIVFVGPSGCGKSTTLRMIAGLEEISKGD
LYIDGKRMNDVPPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLRKFPKAEIDKRVREAAR
ILGLEQYLDRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRSEIAKL
HQRLETTTIYVTHDQTEAMTMATRLVVMKDGVIQQVGTPREVYEKPENIFVGGFIGSPAM
NFLRGTLQDGKFVVGQTSFGIPEGKMKVLREQGYVGKEVILGIRPEDIHDEPLFLEASPA
TKVTALVEVAELLGAESMIYFSIDNQELVARIDARTEIKPGHRIDLALDMNKAHFFDVET
ERRIRAADEK
Download sequence
Identical sequences A0A063YUA2 A0A1C3D2N7 A0A1V9BZM3 A0A2H5KGT9 Q5L2B4 T0NRC9 U2YE33
WP_011230135.1.100150 WP_011230135.1.19233 WP_011230135.1.2219 WP_011230135.1.22479 WP_011230135.1.60903 WP_011230135.1.6497 WP_011230135.1.70239 WP_011230135.1.78869 WP_011230135.1.90668 WP_011230135.1.91533 WP_011230135.1.93593 gi|56419166|ref|YP_146484.1| 235909.GK0631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]