SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419193|ref|YP_146511.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419193|ref|YP_146511.1|
Domain Number 1 Region: 3-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.26e-57
Family SCOPe 0.0000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419193|ref|YP_146511.1|
Sequence length 245
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MTLLEVKDLSGGYTAQNVLEDVTFVVDRGEMVALIGLNGAGKSTTIKHIIGLMEPRRGAI
SINGYRLADGPETYRRQFAYIPETPVLYEELTLEEHLRLAAMAYGLSEAEYERRLPPLLR
EFRLERRLSSFPAHFSKGMKQKVMIVCAFLLEPPLYIIDEPFLGLDPLAIHALLERMNEQ
KAKGAGILLSTHILATAERYCDSFVILHNGRVKAKGTLDDIRRQFGLRGASLDELYVELT
KDDAP
Download sequence
Identical sequences A0A1C3DA47 A0A1V9BZE9 A0A2H5KGP3 Q5L287 T0Q4K6 V6VDB8
gi|56419193|ref|YP_146511.1| 235909.GK0658 4rvc_A WP_011230161.1.100150 WP_011230161.1.2219 WP_011230161.1.22479 WP_011230161.1.25743 WP_011230161.1.45808 WP_011230161.1.60903 WP_011230161.1.6497 WP_011230161.1.70239 WP_011230161.1.78869 WP_011230161.1.90668 WP_011230161.1.91533 WP_011230161.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]