SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419217|ref|YP_146535.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419217|ref|YP_146535.1|
Domain Number 1 Region: 8-184,347-507,558-838,870-896
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-119
Family Tandem AAA-ATPase domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1021-1239
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 1.23e-38
Family Exodeoxyribonuclease V beta chain (RecB), C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419217|ref|YP_146535.1|
Sequence length 1242
Comment ATP-dependent deoxyribonuclease subunit A [Geobacillus kaustophilus HTA426]
Sequence
MNATIRPKPAGSRWTDEQWKAIAAGGRDILVAAAAGSGKTAVLVERIIQKVTAEEGAVDI
DRLLVVTFTNAAAAEMKARIGEALERELAKRPHSLHLRRQLSLLPRAAISTLHSFCLDVI
RKYYYLLDLDPSFRIADETEIELLKEDVLEELLEEEYGKPDNERFFAVVDAYTGDRSDAE
LQEMIVALYEFSRSHPEPDEWLAGLTSMYDVDERTDIKTLPAARYIAQHAAMELAAARRL
IRRALELAEEPGGPRPYAERLREDRDMITDLETRLSGPWAELHRALKALSFGRLPACRGK
DYDERLIDEAKSLRDQAKKKVEALRDNVFSLDPSVWLRHMREMKPIVETIANLVRRFAVM
FQAAKREKGIVDFSDLEHYCLHILRRRDPETGEWQPSPAALEYQAQFDEVLVDEYQDTNL
VQEAILQLVKKGSERTGNLFMVGDVKQSIYRFRLAEPMLFLDKYKRFTADGEEGGMKIDL
ASNFRSRREVLDGTNFLFAQLMGETVGEMVYDEAAQLKYGADYPEGEDAAPEVMIINRQR
AAEEDEEEAAEWEAAELEARLMAKKIKEIVSAPFYVYDRSSGQPRRAMYRDIVILVRSMT
NAPQMIEQLQAQGIPAAADLSSGYFQATEISIMLSLLKVIDNPHQDIPLAAVLRSPLFRF
DENELAMIRLADPKGTFYEALCSFRQKPAETKEEANAQRKAAAFLERLEGWRTMARRRSL
ADLIWQLYRDTQFYDFVGALPGGRQRQANLRALYDRARQYESTSFRGLFRFLRFIERLQE
RGDDLGAARPLGEQEDVVRIMTIHSSKGLEFPIVFLAGLARPFHTRDLHHPYLLDKELGF
AARFVHPRLRISYPTLPLLAIQTKKRLELLAEEMRILYVALTRAKEKLYLLASVNDAAKE
IEKWKSAASERGWLLPDDVRASARSYLDWIGRALIRHRDGGALAGTKAPEEVASHPSVWR
VAIVPAADLRGAEAAREEMDGGVLLALEQGRPVPVEGGWQKEVKRRLLWRYSYEKETAVR
AKQSVSELKEQRALFGEQADEWRPRQGTAPVFSRPRFMQEKTLTPAEKGTALHVVMRHLD
LQAPLDESWIRSQIVRLVEKELLSAEQAEAVDPAAIAAFFTADLGRRLCAAREVHREVPF
SLGLKAAELYGGEGTESGRRVLVQGVIDCVFADECGYVMIDYKTDEVVHRFAGQKEEAAR
FLLGRYGTQMRLYRRAIEQIWRAPVAECYLYSFDGGFVVAVE
Download sequence
Identical sequences Q5L263
gi|56419217|ref|YP_146535.1| WP_011230185.1.2219 235909.GK0682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]