SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419219|ref|YP_146537.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419219|ref|YP_146537.1|
Domain Number 1 Region: 20-186,1004-1097
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-27
Family ABC transporter ATPase domain-like 0.018
Further Details:      
 
Weak hits

Sequence:  gi|56419219|ref|YP_146537.1|
Domain Number - Region: 497-575
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00157
Family Rad50 coiled-coil Zn hook 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419219|ref|YP_146537.1|
Sequence length 1114
Comment DNA exonuclease [Geobacillus kaustophilus HTA426]
Sequence
MKPISLTIAGLHSFREKQTIDFTALCEGGVFGIFGPTGSGKSTILDAMTLALFGSVERAA
NRTQAIINHAEQELFVSFTFELENAAGAKRYTVERSLKKVDEWRTRSAVCRLIEHRSEPV
VLADKLSEVDKAIEQLLGLTMEDFTRAVVLPQGKFAEFLSLKGSERRQMLQRLFHLERYG
DQLNKKLKDRLAAARQEWEKIEAEKAGLGDASKAALEQAEADVRELAGLFAKRKKELEEV
EADVERTKQRWAWQQEKEAVEQELAALRQHESAIRELEAKKERAEQAERIWPYWEQCEQA
CRLRAEAFRRYEGLARRLEEAQLSYEEAARRYERARQEKAQREPELLVQMERLRQAAQLE
QQMEVLGQELAALREERKRLIAQEKAAARRFEEASVWYERGAKRQRELKEELKQHEEALD
GKDEAERAYRQKQHIEQAASAIARVDAQLQQKEAVWRRAKEEKLERERRSAAVGSRLQEL
FRRVERTYRFVCWRQQDAEKQLYTLQKTMEAERQRAEEARTAQLASALAERLRPGEPCPV
CGSREHPHPAAAPHDVQLERLSELEAERQRYEQDWQMIISFKAQLEQLAELAAGHEAPPV
FAESRSVEEVVDLTVEVRALAQDVIELKEAAYRVLAQWNEAESARREAEKACQWIAADIE
ALQVEKQRLEEERRQLEQQWRQMYPFHSLETIDAVYEQLCELENVRRDVQKRLEDSVLFL
EEKQRAKEEAAKERSRLETERVRLDSLISAKQQQWNEYERQRGEKAGEGPAAVQLQKAED
EWRQLQNGEQQAYEAWQRAQREYQMLESETKAAKQAWEEGVRREEEALARWRGALLDTMF
ADAEQVKQAKAEKAQRDEWDEAIRRYWRQIEQAEHRLAQLAAAIGGAAVSAEQWETMQRV
YAELKGQVEAMTQQLGAAQAKVEELRKKHSRFVELEEKQAELSRRIERYKQLQALLRGNS
FVEFMAEEQLEQVTAMASERLQRLTRHRYSLELDSQGGFLIRDDANGGVRRPVSTLSGGE
TFLTSLSLALALSAQIQLRGEYPLRFFFLDEGFGTLDAELLETVISALEKLHTERLAVGV
ISHVQEIRHRLPRRLIVEPAEPSGRGTRVWLEMM
Download sequence
Identical sequences Q5L261
gi|56419219|ref|YP_146537.1| WP_011230187.1.2219 235909.GK0684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]