SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419244|ref|YP_146562.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419244|ref|YP_146562.1|
Domain Number 1 Region: 335-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.13e-72
Family Extended AAA-ATPase domain 0.00000143
Further Details:      
 
Domain Number 2 Region: 550-641
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000108
Family FIS-like 0.034
Further Details:      
 
Domain Number 3 Region: 59-197
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000883
Family IclR ligand-binding domain-like 0.036
Further Details:      
 
Domain Number 4 Region: 210-265
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000138
Family PYP-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419244|ref|YP_146562.1|
Sequence length 643
Comment acetoin operon expression regulatory protein [Geobacillus kaustophilus HTA426]
Sequence
MIVTREQVKSMWEKFVFHNELDPDLPPMIRDSWLRSKKAMVDPFRPYGWIKEIDNEKYRS
LIDWSLPLMEGLYSIVKGSGFLVILCNENGQLLLSIGDCEPLARAEEIGFIAGADWSEQV
MGTNAIGTSIVIDRPIQVFAEEHYTKICQSWTCSAAPIHDPDGRIIGVLNMSGPYEKVHS
HTLGMVVSAVKAIEYQLKLHENAEKNVMMQRFLEATTNNMKEGILIIDRDGKIVKANNQL
KKLFHIPQLQLEEKKLDDLFNDPSICSNHPLHLQNQELHLSVKPSNAVHHVLVDKIPIYE
KKERIGSMIIVKEIEKVRQFVNHLSGNQAKITFADMIGQHPCFIEKMNEARLAAATDSNV
LILGESGTGKEMVAQAIHNESKRRNKPFIAINCGGIPRDLLGSELFGYVDGAFTGAKKGG
SAGKFELANGGTLFLDEIGEMSLEMQVLLLRVIQEKEVMRIGGHKVIPVDVRIIAATNKD
LRREVQKGSFREDLFFRLNVMPIVLPPLRERKEDIPLLVRHFIERLAHKRDKPFPEIRSD
FLEALMQYDWPGNIRELQNMIERVLNQCTKPVLTAADLPEEIFRPLRLPQVRENVDISRN
EIKKQSIIEALKQCNGNISKAARYLGISRSTFYRQMDKWNIRY
Download sequence
Identical sequences Q5L236
WP_011230212.1.2219 235909.GK0709 gi|56419244|ref|YP_146562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]