SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419258|ref|YP_146576.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419258|ref|YP_146576.1|
Domain Number 1 Region: 6-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.31e-86
Family ABC transporter ATPase domain-like 0.00000119
Further Details:      
 
Domain Number 2 Region: 239-344
Classification Level Classification E-value
Superfamily MOP-like 0.000000000000251
Family ABC-transporter additional domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419258|ref|YP_146576.1|
Sequence length 353
Comment spermidine/putrescine ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MNGEEIIRFERVTKEYDGTVVLDDVSFAMERGKFYTLLGPSGCGKTTILRLIAGFIEPTE
GTIYFHGKPIQNVPPNKRQVNTVFQDYALFPHLDVFENVAFGLRVKKMKEADIRQKVSEA
LRFVNLEGYERRRIQEMSGGQRQRVAIARAIVNEPEVLLLDEPLSALDLKLRTEMQYELR
ELQRRLGITFIFVTHDQEEALAMSDYIFVLNKGKIQQFGTPKDIYDEPINRFVADFIGES
NILSGRMIDDFLVEFAGKQFACVDRGFAPNEPVDVVIRPEDLELAAPEDGQIVIRVDSLL
FRGVHYEICGYDENGNEWLVHSTKKAEVGETVGLRFEPEAIHVMRVEREDEGA
Download sequence
Identical sequences A0A1C3D6Q1 A0A1V9C953 Q5L222
235909.GK0723 gi|56419258|ref|YP_146576.1| WP_011230226.1.2219 WP_011230226.1.22479 WP_011230226.1.38928 WP_011230226.1.90668 gka001000723.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]