SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419308|ref|YP_146626.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419308|ref|YP_146626.1|
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-16
Family Nitrogenase iron protein-like 0.0000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419308|ref|YP_146626.1|
Sequence length 166
Comment molybdopterin-guanine dinucleotide biosynthesis protein [Geobacillus kaustophilus HTA426]
Sequence
MNVWQVVGYKHSGKTTLMEKWVAAAVREGWRVGTVKHHGHGGEPARPEGVDSVRHERAGA
AATAVEGAGLLQLHLRRPLWRLDDVLALYAPLQLDLVLVEGYKQERHPKVVLVRSEEDWT
SLQHLADIRAVIAWVPLSRPLPYPVFLLADEAEYIPWLMNEVRRRT
Download sequence
Identical sequences A0A098L567 A0A0N0I489 Q5L1X2
235909.GK0773 gi|56419308|ref|YP_146626.1| WP_011230275.1.2219 WP_011230275.1.60903 WP_011230275.1.78869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]