SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419416|ref|YP_146734.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419416|ref|YP_146734.1|
Domain Number 1 Region: 29-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.51e-26
Family Extended AAA-ATPase domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419416|ref|YP_146734.1|
Sequence length 266
Comment hypothetical protein GK0881 [Geobacillus kaustophilus HTA426]
Sequence
MYKSFYSLSREPFAKETDPSEAYQGAPFQEALRALEYVKRTRGIGLLIGEPGAGKTFALR
ALKESLNPSLYHVVYFPLSTGGVMDFYRGLALGLGEEPKYRKVDLFRQIQQAIERLYHER
RITPVFILDEMHLAKDAFLQDIAILFNFEMDSTNPFVLILAGLPHLQGKLRLNQHRPLDQ
RIIMRYRMGPLEKEEVAGYIKHRMKQAGAKHPIFTPSALEAIALQSRGWPRVINTLATTC
LLYGYQLKKDAIDEEVVRMAAEEMGY
Download sequence
Identical sequences A0A023DKQ4 A0A0Q0UZI3 A0A1D7NEM1 A0A1W6VP10 A0A223DYZ3 G8MWZ1 Q5L1L4
gi|375008991|ref|YP_004982624.1| gi|56419416|ref|YP_146734.1| 235909.GK0881 WP_011230382.1.10946 WP_011230382.1.2219 WP_011230382.1.26402 WP_011230382.1.36263 WP_011230382.1.41580 WP_011230382.1.6497 WP_011230382.1.8599 WP_011230382.1.90235 WP_011230382.1.9608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]