SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419420|ref|YP_146738.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419420|ref|YP_146738.1|
Domain Number 1 Region: 25-59,410-613
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000016
Family ABC transporter ATPase domain-like 0.027
Further Details:      
 
Weak hits

Sequence:  gi|56419420|ref|YP_146738.1|
Domain Number - Region: 272-330
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0085
Family Rad50 coiled-coil Zn hook 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56419420|ref|YP_146738.1|
Sequence length 804
Comment hypothetical protein GK0885 [Geobacillus kaustophilus HTA426]
Sequence
MIRQIDILEYGPYKNYRWVDIFGNDLDEGFGCRNIIYGRNYAGKTTFSRIIRSLELGKPH
KDFNNGKFIITLDDGKQITELDLDDGPYNIRVYNADFKKDNLSFLYDENGEILPFAILGE
ENIEIQYKIEQEEKKIQEIREKLYNPDHGVHKKYNDNRKFLDKLEKELSKILREKASQIR
NNPNLFLANQKKQYDIRDIEQEIPFANSSLEEQEKKELENTIKENIKEIVPRCSKLDFDY
MELIDKAILLLSMSLKPSKIIESLANNNDLQEWVREGIGLHKGILEECAFCGNKIDVSRW
EELDRHFTREVEEFTENLEKLMDKIKEKKEYILNYQLPFDKYSFYSIFEEDYHLIERELD
LLQEEAVSELDEVYRVLGERRKNLFSPSNMLRKDGDINLKANKLLSKINTLINKNNEYTL
KYTEKQNEARKKLRYDEIYRFKKLINYEEKKAAIENQRNLLQEINNEKEKLEKIEKESLL
KKAELEASLKDEKNAVKLVNNYLKSFLGHPELYLDIEEEGASKKISKFVVKRNNQKAKNL
SEGEQSLIAFCYFLATLKDISNIEEYTIFIDDPISSLDSNHIFYVFSLIDSEIASKNYKQ
VFISTHNLDLLKYLQKLTKPTNNKKYNNKYYLIEKKLTANGEATSIITRMPTYLQTYSTE
FIFLFHQIYRVATEDQSDENYEVFYSFPNTARKFIETYMFFKYPDFTMKNDKRIREFFGG
KLEFVSFLNRINNEFSHGENQPDRLFKPIDIPEFKKNALIILDSIRRNDEEQYYAFLRSI
NALPHDAISKKEDNILVNSMGTVS
Download sequence
Identical sequences Q5L1L0
gi|56419420|ref|YP_146738.1| 235909.GK0885 WP_011230386.1.2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]