SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419648|ref|YP_146966.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419648|ref|YP_146966.1|
Domain Number 1 Region: 190-584
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.9e-95
Family beta-Lactamase/D-ala carboxypeptidase 0.00000312
Further Details:      
 
Domain Number 2 Region: 55-239
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 5.36e-44
Family Penicillin binding protein dimerisation domain 0.0000761
Further Details:      
 
Domain Number 3 Region: 657-709
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0074
Further Details:      
 
Domain Number 4 Region: 600-653
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000327
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56419648|ref|YP_146966.1|
Sequence length 736
Comment penicillin-binding protein 2B [Geobacillus kaustophilus HTA426]
Sequence
MEARKHRNTHQGAFILFCLFGFLFSLLFARFVQLEWTGKADGQTLAVIAERQHQQTRTIK
AKRGTIFDRNGAILAEDVPSYTVVAILDPKMTTDPDHPHHVVDPKKTAEQLAPLLGMDVE
AMERILTKKAKQVEFGAYGRNISFELKRKIEALHLPGIAFIRDTSRFYPNGMFASHVIGY
AQKNAANETVGKMGVEKELDRYLREEDGYVSFAGDINGFRLPGGKERIVKPDNGANVYLT
IDGKIQSFLEDAMNSVEKQYKPKKMIAIVADPKTGKILAMATRPSFDPNKRDITNFLNDA
ISYPYEPGSTMKVFTLAAAINEGVYNGNETYRSGSYKVGPNTIRDHNDVGWGTITFNEGV
QRSSNVAFSILVKEKLGEDRFLQYLHRFHFDRKTGIDLPNEAVGQIRYRYPIERITTGFG
QGTSVTPIQQIQAATAIANDGKMMKPYVIEKVVDPDSGKVVLDHGPTVVGEPITAETARK
VRAILETVVTSEHGTGRPYQINGYRVAGKTGTAQIPSASGGYLTGRENYIFSFLGMAPTD
DPKLLMYVAVQQPHLDVTETGAAPVSQIFTTVMKSSLQYLHIEPNGEKRMKAKTAQPQAL
DSWIGQPAASAAEQLKEKGYVPVVIGRGKYVEQQLPQGGDHVLLGERVVLKTDGAATMPD
LRGFSLRDAMKVAHILGLRPSTKGTGYVVSQNIRPGAEVRKGDYLIVELAPPRQWEKEAA
EKEKEAALRKEAEPHE
Download sequence
Identical sequences A0A063YSD4 A0A098L6Z5 A0A1D7NA24 A0A2H5KFL7 G8N0B7 Q5L0Y2 U2X6G5
gi|56419648|ref|YP_146966.1| gi|375008079|ref|YP_004981712.1| WP_011230613.1.19233 WP_011230613.1.2219 WP_011230613.1.45808 WP_011230613.1.6497 WP_011230613.1.78869 WP_011230613.1.8599 WP_011230613.1.91533 WP_011230613.1.93593 235909.GK1113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]