SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419649|ref|YP_146967.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419649|ref|YP_146967.1|
Domain Number 1 Region: 170-568
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.59e-104
Family beta-Lactamase/D-ala carboxypeptidase 0.0000259
Further Details:      
 
Domain Number 2 Region: 52-219
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 8.24e-48
Family Penicillin binding protein dimerisation domain 0.00091
Further Details:      
 
Domain Number 3 Region: 583-635
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419649|ref|YP_146967.1|
Sequence length 644
Comment sporulation specific penicillin-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MRVSYVTVRKRLTIVFLIGILIFAIIDLRLGYVQFWLGDLLAERAKGLWGRNIPFEPKRG
EILDRNGVPLATNMSAPTVYVIPRQVKNPAEAAKKLAGVLGGSIESIYKQITQKTSIVRL
KEGRKISDEKAANVRSLDLDGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLTGLELYYD
KELRGERGSVQFYSDAKGRRMPDIADDYTPPTDGLNLVLTIDSRIQTIIERELDIAEAKY
NPDGIIAIAMDPNTGEILAMASRPTFNPADYRSVPPEIYNRNLPIWSTYEPGSTFKIITL
AAALEEHKVNLLKDHFFDPGYAKVAGATLRCWKKGGHGDQTFLEVVQNSCNPGFVELGER
LGKETLFRYIKQFGFGEKTGIDLQGEGTGILFDLKRVGPVELATTAFGQGVSVTPIQQVA
AVSAAINGGILYTPYIAKQWVDPETGEIVRRNTPKAKRRVISEETSKQVRYALESVVAQG
TGKKAYVEGYRVGGKTGTAQKAQGGRYLQNNHIVSFIGFAPADDPKLVVYVAVDNPKGTV
QFGGTVAAPIVGKIMEDSLRTLGVKPRKDQLEKERDWNEPKVIEVPNLIGMTKNDLQEQL
FDLKLDVSGEGDVVVEQSPKPGAKVKEGSTVRIYLAKREAVEER
Download sequence
Identical sequences A0A063YUH4 A0A098L5G9 A0A1D7N9V3 A0A2H5KFN4 G8N0B8 Q5L0Y1 U2WUS6 V6VDE4
235909.GK1114 gi|56419649|ref|YP_146967.1| WP_011230614.1.19233 WP_011230614.1.2219 WP_011230614.1.25743 WP_011230614.1.45808 WP_011230614.1.6497 WP_011230614.1.78869 WP_011230614.1.8599 WP_011230614.1.90668 WP_011230614.1.91533 WP_011230614.1.93593 gi|375008080|ref|YP_004981713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]