SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419711|ref|YP_147029.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419711|ref|YP_147029.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-86
Family Protein kinases, catalytic subunit 0.000000985
Further Details:      
 
Weak hits

Sequence:  gi|56419711|ref|YP_147029.1|
Domain Number - Region: 500-562
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 364-425
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 432-488
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0628
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419711|ref|YP_147029.1|
Sequence length 656
Comment serine/threonine protein kinase [Geobacillus kaustophilus HTA426]
Sequence
MLIGKRLNDRYKIISLIGGGGMANVYLARDMILERDVAVKVLRLDFANDDQFIKRFRREA
QAATSLNHEHIVSIYDVGEEEGVYYIVMEYVRGATLKQYIQQHAPLPVERALGIMDQLTS
AIAHAHENGIIHRDIKPQNILLDEHGNVKVTDFGIAVAMSGTTITQTNSVLGSVHYLSPE
QARGGIATEKSDIYSLGIVMFELVTGRLPFSGESAVSIVLKHLQAETPSPKAWNPDIPQS
VENIILKATAKDPFYRYQSAREMNEDIRTALDPRRRNEPKFTIPDDDEEATKAIPMIKHA
ESAALEQETLVYEEKTSEPVHTTGEPKPKRKRVWIAWLVAALLFIGAAGISAVTWIPDLI
FPKEVTMPNVVNKNYDDAVEQLSSLGLEIKDTIDVEDDQIEEGKVVRTDPEAGMTVKKGA
GVIIYKSIGKKKIEFPSFIGDDIAAAEEELRAEGFTRITRSGRYSDKPEGTILDQYPYAG
DEVVPDETEVMFTVSLGPEKVTVKDLTGYTEKSVRDYGADQGLRIDVKYEYSDEVPEGLV
ISQTPAANERVKKGETITVVISRGPEPKPSKTVVKEIMIPYEPAMPGQMVEAQLYIQDAT
HNMSTPYKTYRLTAPATEMVEFEIPYGETAYYRVIVNNVVKEEGSIPYPENNGKKG
Download sequence
Identical sequences A0A063YUP3 A0A1D7NGB2 A0A1V9C130 G8N169 Q5L0R9
gi|56419711|ref|YP_147029.1| 235909.GK1176 gi|375008144|ref|YP_004981777.1| WP_011230676.1.100150 WP_011230676.1.19233 WP_011230676.1.2219 WP_011230676.1.25743 WP_011230676.1.45808 WP_011230676.1.6497 WP_011230676.1.70239 WP_011230676.1.78869 WP_011230676.1.8599 WP_011230676.1.90668 WP_011230676.1.91533 WP_011230676.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]