SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419712|ref|YP_147030.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419712|ref|YP_147030.1|
Domain Number 1 Region: 64-291
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-59
Family G proteins 0.000000189
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-16
Family Cold shock DNA-binding domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419712|ref|YP_147030.1|
Sequence length 293
Comment ribosome-associated GTPase [Geobacillus kaustophilus HTA426]
Sequence
MAEGQIIKALSGFYYVLSEGRVFQCRGRGVFRKKKVTPLVGDRVVFQATSETEGYILEIG
ERQNELVRPPIANVEQAILVFSAVSPDFSAKLLDRFLVLVESKRITPIIVISKIDLLDGE
SKEEIARYVHDYRRIGYDVIETSAVTKGGLDELALRLRGRVSVVAGQSGVGKSSLLNALR
PDLRLKTGDISTHLGRGKHTTRHVELLEVAGGLVADTPGFSALEFNQIELDELPHYFPEF
RTYGEGCKFRGCLHIAEPKCAVREAVEAGEIPSYRYDHYVSFVAEMKERKPRY
Download sequence
Identical sequences Q5L0R8
gi|56419712|ref|YP_147030.1| WP_011230677.1.2219 235909.GK1177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]