SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419731|ref|YP_147049.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419731|ref|YP_147049.1|
Domain Number 1 Region: 43-355
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.84e-63
Family Nitrogenase iron protein-like 0.00000388
Further Details:      
 
Domain Number 2 Region: 328-430
Classification Level Classification E-value
Superfamily Signal peptide-binding domain 5.56e-39
Family Signal peptide-binding domain 0.0000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419731|ref|YP_147049.1|
Sequence length 446
Comment signal recognition particle GTPase [Geobacillus kaustophilus HTA426]
Sequence
MAFEGLSERLQQVMNRIRGKGKVTEADVKEMMREVRLALLEADVNFKVVKDFIRQVSERA
VGQEVMKSLTPGQQVIKIVKEELTALMGGEQSQIAVAKKPPTVVMMVGLQGAGKTTTTGK
LANLLRKRHNRKPLLVAADVYRPAAIKQLETLGKQLDMPVFSLGEHANPVEIAKQALERA
KEEHYDYVLIDTAGRLHIDEALMDELKQMKEAVKPDEIFLVVDAMTGQDAVNVAQSFHEQ
LGITGVILTKLDGDTRGGAALSIRAVTGAPIKFAGMGEKLDALEPFHPERMASRILGMGD
VLTLIEKAQAAVDEEKAKELEQKMRTATFTLDDFLEQLGQVRKLGPLDELIKMLPGANKI
KGLANIQVDEKQIARVEAIIRSMTKEEKTHPEIINASRKKRIAKGSGTTVQEVNRLLKQF
DEMKKMMKMMTNMPKGKKKGFRFPFM
Download sequence
Identical sequences A0A0E0TA38 A0A0K2H568 A0A142CZC1 A0A1C3D800 A0A1V9CTE9 A0A2H5KFG4 L7ZWZ7 Q5L0P9 V6VDN3
gi|56419731|ref|YP_147049.1| gi|297530628|ref|YP_003671903.1| WP_011230696.1.17728 WP_011230696.1.20723 WP_011230696.1.2219 WP_011230696.1.22479 WP_011230696.1.25743 WP_011230696.1.38928 WP_011230696.1.45808 WP_011230696.1.46340 WP_011230696.1.50933 WP_011230696.1.59104 WP_011230696.1.60903 WP_011230696.1.6497 WP_011230696.1.70239 WP_011230696.1.78869 WP_011230696.1.90668 WP_011230696.1.91533 WP_011230696.1.92435 gi|319766210|ref|YP_004131711.1| gi|448237352|ref|YP_007401410.1| 235909.GK1196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]