SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419757|ref|YP_147075.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419757|ref|YP_147075.1|
Domain Number 1 Region: 77-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.82e-98
Family RecA protein-like (ATPase-domain) 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56419757|ref|YP_147075.1|
Sequence length 422
Comment flagellum-specific ATP synthase [Geobacillus kaustophilus HTA426]
Sequence
MYKRFGKVSRVIGLMMESKGPKSSIGDLCYIHEQSGCRKIPAEVVGFHEQHVLLMPFSAM
SHIAPGCLVEATGRPLEVHVGDALIGMVLDPLGQPLDGSPLPPGLKPVSVERDPPNPLVR
PPIVEPLEVGIRVIDSLLAVGKGQRVGIFAGSGVGKSTLMGMIARHTSADVNVIALIGER
GREVREFLERDLGPDGLARSVVVVATSDQPALMRVKGAYTATAIAEYFRDQGADVMLMMD
SVTRVAMAQREIGLAVGEPPTTKGYTPSVFALLPKLLERAGTNASGTITAFYTVLVDGDD
MNEPIADAVRGILDGHFVLERQLANKGHYPAINVLKSVSRVMPHMISAEHREAANRFRRL
LSTYIDSEDLIQIGAYKRGSSQEIDEAIEFYPQMMAFCRQNIDEKTTRAESIDALLRLLS
VR
Download sequence
Identical sequences A0A1C3D812 Q5L0M3 V6V9W7
gi|56419757|ref|YP_147075.1| 235909.GK1222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]