SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419774|ref|YP_147092.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419774|ref|YP_147092.1|
Domain Number 1 Region: 210-405
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.3e-36
Family Nitrogenase iron protein-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419774|ref|YP_147092.1|
Sequence length 409
Comment flagellar biosynthesis regulator FlhF [Geobacillus kaustophilus HTA426]
Sequence
MKVKKFVAPSMNEAMKMVRAELGRDAVILHSKVVQTGGFFGLFAKKKIEVLAGVDPDPLP
PRQPDAAASLTRQPSAAASLTRQPSAAASLTRQPDAAASLTRQPSAASFAPLPAAEREED
GSLAREIEEVKALIRQFNARSSSLLYPPPLAEAERRLVRQGMADVYVRQVMDRLLERWYA
DKDSRSPAAVSAWTKEAVRDLLSTLPFVKTAEQKKYMILLGPTGVGKTTTLAKMAGRAVL
EQGKKVGFITADTYRIAAIDQLKTYADILHAPLEVCYNADDFRTAKRKLAGCDLVFVDTA
GRNFRNPQYVDELQQTLEFDSETETFLVFAATGKYDDMKMIYNHFSRLPIDRLIVTKLDE
TDSFGTIVNVLLDSRLAAAYFTNGQNVPDDMVEASADRLVHLLFGAERW
Download sequence
Identical sequences A0A1V9C1C5 Q3V7T7
WP_011230739.1.2219 WP_011230739.1.70239 gi|56419774|ref|YP_147092.1| 235909.GK1239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]