SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419816|ref|YP_147134.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419816|ref|YP_147134.1|
Domain Number 1 Region: 387-681
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-49
Family RecA protein-like (ATPase-domain) 0.035
Further Details:      
 
Domain Number 2 Region: 708-772
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.2e-23
Family FtsK C-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419816|ref|YP_147134.1|
Sequence length 776
Comment DNA translocase [Geobacillus kaustophilus HTA426]
Sequence
MAKRKRRRKGKPSKTQPWTETIRFELIGLGLLAVAVVAMARLGLVGETLVLVGRFFFGEW
YMLLVGGLFLLSLIVMWRREWPSWTGRPFVGASSIAAALLLLSHDKLFELMSRRGELDPS
IIRTTWGLFWNEASGKAADVDLGGGMVGALLFAASYQLFDSPGTKWICFLLFIVGFVVLT
GKSLRETAGKWVAFAAAFVRKEWLAFVEDIKQWRAGRKRKESGGRSRRSRRAAAKREDEP
AEASSVEPDEELLSPPPIISDFAAVRSAAEPEEEKNPLVEGDSGGEEDKPAPPLAFSEHE
NTNYDLPPLDLLRLPKPAGQSADHANIYANARKLEKTFQSFGVKAKVTQVHLGPAVTKYE
VYPDVGVKVSKIVSLSDDLALALAAKDIRIEAPIPGKSAIGIEVPNEEIATVSLREVLEA
IEHTRDKAKLLIPLGRDISGEVVAAELNKMPHLLIAGATGSGKSVCINGIIVSLLMRTKP
HEVKLMMIDPKMVELSVYNGVPHLLTPVVTDAKKAAQALKKVVQEMERRYELFSHTGTRN
IEGYNEHIRHHNETASEQQPLLPYIVVIIDELADLMMVASSDVEEAITRLAQMARAAGIH
LIIATQRPSVDVITGVIKANIPSRIAFSVSSQIDSRTILDMGGAEKLLGRGDMLFLPMGA
SKPVRVQGAFVSDQEVEEVVRFVIGQQQAQYYEEMFVEDSEPSSSALEDELYDEAVRLVV
EMQSASVSMLQRRFRIGYNRAARLIDAMEERGVVGPYEGSKPRAVLWSKEDLKKTS
Download sequence
Identical sequences A0A098L3N7 A0A1C3D871 A0A1V9C0Y2 A0A2H5KF74 Q5L0H0 S4NMN1 T0NSV0 V6VCM1
235909.GK1281 WP_011230781.1.100150 WP_011230781.1.2219 WP_011230781.1.22479 WP_011230781.1.25743 WP_011230781.1.45808 WP_011230781.1.60903 WP_011230781.1.6497 WP_011230781.1.70239 WP_011230781.1.78869 WP_011230781.1.8599 WP_011230781.1.90668 WP_011230781.1.91533 WP_011230781.1.93593 gi|56419816|ref|YP_147134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]