SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419819|ref|YP_147137.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419819|ref|YP_147137.1|
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.69e-61
Family ABC transporter ATPase domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 238-491
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-48
Family ABC transporter ATPase domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419819|ref|YP_147137.1|
Sequence length 508
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MEYVIEMLNIRKVFGTFVANDNITLQVKKGEIHALLGENGAGKSTLMNVLFGLYQPDGGE
IRVKGKPVRITDPNVANDLGIGMVHQHFMLVDTFTVTENIILGSEPTRAGTIDMKRAERE
VRELSERYGLAVDPTAKIADISVGMQQRVEILKTLYRGADILIFDEPTAVLTPQEIRELM
QIMRTLVREGKSIILITHKLKEIMEVCDRVTVIRRGKGIATLNVAETNPNELAALMVGRE
VQFTTAKKPAEPGKPVLEIKDLVVKDARGIKAVNGLNLTVHAGEIVGIAGVDGNGQTELI
EAITGLIKAESGTIRLNGRDITNLPPRKIIEAGVGHIPQDRHKHGLVLDFPIGENMVLQT
YYQPPYSKRGLLNFQAIYEKARQLIREFDVRTPDEYTKARALSGGNQQKAIIGREVDRDP
DLLIAAQPTRGLDVGAIEFIHKRLIEQRDRGKAVLLVSFELDEVMNVSDRIAVIYEGNIV
AIVDPKETTEQELGLLMAGSKRKEAGVS
Download sequence
Identical sequences A0A063YY40 A0A0K2H5U8 A0A142CZJ8 A0A1C3D913 A0A1Q5T3P6 A0A1V4PAJ0 A0A1V9CN46 A0A2H5KF70 G8N1Z7 L7ZXG3 Q5L0G7 S4NH08 T0NJG9
gi|56419819|ref|YP_147137.1| gi|448237440|ref|YP_007401498.1| WP_011230784.1.100150 WP_011230784.1.17728 WP_011230784.1.19233 WP_011230784.1.2219 WP_011230784.1.22479 WP_011230784.1.3446 WP_011230784.1.38928 WP_011230784.1.45808 WP_011230784.1.59104 WP_011230784.1.60903 WP_011230784.1.6497 WP_011230784.1.70239 WP_011230784.1.77642 WP_011230784.1.78869 WP_011230784.1.8599 WP_011230784.1.90668 WP_011230784.1.91533 WP_011230784.1.92435 WP_011230784.1.93593 235909.GK1284 gi|375008259|ref|YP_004981892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]