SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419826|ref|YP_147144.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419826|ref|YP_147144.1|
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily ACT-like 0.000000000708
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|56419826|ref|YP_147144.1|
Domain Number - Region: 114-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00974
Family Nucleotide and nucleoside kinases 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419826|ref|YP_147144.1|
Sequence length 263
Comment hypothetical protein GK1291 [Geobacillus kaustophilus HTA426]
Sequence
MGKQEWYLEYEIHVNRPGLLGDVASLLGMLSINIVTINGVRDSRRGMLLLCDNNEQIERL
ATILRTMDNITVTKLRQPKLLDRLAVRHGRYIQRDADDKKTFRFVRDELGLLVDFMAELF
KEKGHKLIGIRGMPRVGKTESIVAASVCANKRWLFVSSTLIKQTVRTQLMEDEYSEDNIF
IIDGIVSTRRGNEQHWQLIRELMRLEATKVVEHPDMFVRHTEYTLDDFDYIIELRHEPDE
DISYEAIDRPSLLGDDGFSEFGF
Download sequence
Identical sequences A0A063YVQ3 A0A098L525 A0A0E0TAD1 A0A0K2H4W9 A0A1C3D880 A0A1V9C1H9 A0A2H5KF62 G8N204 Q5L0G0 S4NMN8 T0Q626 V6VC99
APC35855 gi|375008266|ref|YP_004981899.1| 235909.GK1291 544556.GYMC61_2077 gi|56419826|ref|YP_147144.1| gi|297530534|ref|YP_003671809.1| gi|261419493|ref|YP_003253175.1| WP_011230791.1.100150 WP_011230791.1.13089 WP_011230791.1.19233 WP_011230791.1.2219 WP_011230791.1.22479 WP_011230791.1.25743 WP_011230791.1.45808 WP_011230791.1.46340 WP_011230791.1.50933 WP_011230791.1.59104 WP_011230791.1.60903 WP_011230791.1.6497 WP_011230791.1.70239 WP_011230791.1.78869 WP_011230791.1.80994 WP_011230791.1.8599 WP_011230791.1.90668 WP_011230791.1.91533 WP_011230791.1.93593 gi|319766310|ref|YP_004131811.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]