SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419830|ref|YP_147148.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419830|ref|YP_147148.1|
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.85e-23
Family RecA protein-like (ATPase-domain) 0.0000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419830|ref|YP_147148.1|
Sequence length 101
Comment hypothetical protein GK1295 [Geobacillus kaustophilus HTA426]
Sequence
MNQDRQAALEQALKQIERQFGKGAIMKLGEQVDRKVSVVPSGSLALDIALGVGGYPRGRI
VEIYGPESSGKTTVALHAIAEVQKRGGQAAFIDAEHGATCC
Download sequence
Identical sequences A0A063YTW4 A0A098L3M4 A0A0G3XW15 A0A0J0V2V7 A0A0N0Z2Q0 A0A0Q1IJ25 A0A150N9A5 A0A1D7NAA7 A0A1V9C1C2 A0A223E008 G8N208 L7ZQI6 Q5L0F6 T0NT04 V6VHA5
gi|375008270|ref|YP_004981903.1| WP_011230795.1.100150 WP_011230795.1.17728 WP_011230795.1.19233 WP_011230795.1.20723 WP_011230795.1.2219 WP_011230795.1.24107 WP_011230795.1.25743 WP_011230795.1.26402 WP_011230795.1.38928 WP_011230795.1.43576 WP_011230795.1.44827 WP_011230795.1.45808 WP_011230795.1.46340 WP_011230795.1.54348 WP_011230795.1.57889 WP_011230795.1.60903 WP_011230795.1.62042 WP_011230795.1.6497 WP_011230795.1.65208 WP_011230795.1.70239 WP_011230795.1.72400 WP_011230795.1.78869 WP_011230795.1.8599 WP_011230795.1.86012 WP_011230795.1.90668 WP_011230795.1.91533 WP_011230795.1.9165 WP_011230795.1.92435 WP_011230795.1.93593 gi|56419830|ref|YP_147148.1| gi|297530530|ref|YP_003671805.1| 235909.GK1295 gi|448237451|ref|YP_007401509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]