SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419841|ref|YP_147159.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419841|ref|YP_147159.1|
Domain Number 1 Region: 249-549
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.97e-92
Family DNA repair protein MutS, domain III 0.00000126
Further Details:      
 
Domain Number 2 Region: 551-783
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.79e-66
Family ABC transporter ATPase domain-like 0.000000384
Further Details:      
 
Domain Number 3 Region: 1-105
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 7.59e-42
Family DNA repair protein MutS, domain I 0.0000226
Further Details:      
 
Domain Number 4 Region: 107-261
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 7.85e-31
Family DNA repair protein MutS, domain II 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419841|ref|YP_147159.1|
Sequence length 896
Comment DNA mismatch repair protein MutS [Geobacillus kaustophilus HTA426]
Sequence
MIQQYLHIKAQYPDAFLFFRLGDFYELFFDDAIKAAQELEITLTSRDGGDERVPMCGVPY
HSAQGYIEQLIEKGYKVAICEQVEDPKTAKGVVRREVVQLITPGTLMEGKGLTEKENHYL
AALTPFADGTYGLAYADLSTGEVRLTLLSSWEEAANELHAVGAREIIVATDSGEEWVREL
KERYGAAVSYEDDTSLCDEWNGVIGHVAQEKLRQAAARLLHYLVRTQKRRLDHLQPAELY
QVDHYMKMDRHSKLHLELVETVRSKGRKGSLLWLLDETVTAMGGRLLKQWLDRPLIDRRE
IERRLDFVETLKTSYFERQELRDRLRGVYDIERLVGRVSYGNANARDLVQLKKSLLQVPA
LRQTVGALPLAEADKLCERLDPCEELVDLLERSIQEQPPLSVKEGNLIKDGYDKQLDRYR
DASRNGKAWIAELEAKEREATGIKSLKVGYNRVFGYYIEVTKPNLPLVPEGRYERKQTLA
NAERFITPELKEKEALILEAEEKSIELEYELFVAIREQVKQYIPRLQTLAKAIAELDVLQ
SFATISDEYRYVRPQFSTERVLVIQGGRHPVVEKVLGAQMYVPNDCYMNREREMLLITGP
NMAGKSTYMRQVALTAVMAQIGCFVPAERAVLPIFDQVFTRIGAADDLSAGQSTFMVEML
EARHAIAHATQNSLILFDEIGRGTSTYDGMALAQAIIEYIHDHIGAKTLFSTHYHELTAL
ERSLPRLSNVHARAIEENGKVVFLHQIADGPADKSYGIHVAELAGLPASLIERARAILAE
LEKAAGKQEAAAGRMDDGALAEAGLAFQGNEALDVGSKVEREKASRPSAGAAREGVLAEA
AFEQLSMFPDLAPAPVEPPLSSKEKKALAALKEINLLEMTPLEALNKLYELQKLLK
Download sequence
Identical sequences A0A098L4X2 Q5L0E5
235909.GK1306 gi|56419841|ref|YP_147159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]