SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419849|ref|YP_147167.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419849|ref|YP_147167.1|
Domain Number 1 Region: 43-293
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.47e-43
Family Extended AAA-ATPase domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419849|ref|YP_147167.1|
Sequence length 310
Comment spore formation protein [Geobacillus kaustophilus HTA426]
Sequence
MSELTMNKAKGQINIVLNSKTVNHLVKEERNDWLDGEEHQALRNIQKELDQLIGLDHVKK
IIKEIYAWLYINRLRKENGLKANRQALHMIFKGNPGTGKTTVARLLGKLFFEMNVLSKGH
FIEAERADLVGEYIGHTASKTRDLIKKARGGILFIDEAYSLARGGEKDFGKEAIDTLVKG
MEDYCDDLVVILAGYPKEMDYFLSLNPGLPSRFPLTIEFPDYTVEELVQIAKQMLREREY
EMTPEAERKLYIHLEGTLEATGRLKFSNGRYVRNLIEKAIRKQAVRLLHEGRYDKKELMT
IRDRDLVIHA
Download sequence
Identical sequences A0A063YRT0 A0A0E0TAE0 A0A0K2H547 A0A1D7NAC7 A0A1Q5SVA1 A0A1V4P8F4 A0A1V9BZ26 A0A2H5KF30 G8N2H8 L7ZYH4 Q5L0D7 T0NT58 V6VBT4
WP_011230813.1.100150 WP_011230813.1.17728 WP_011230813.1.19233 WP_011230813.1.2219 WP_011230813.1.25743 WP_011230813.1.3446 WP_011230813.1.45808 WP_011230813.1.46340 WP_011230813.1.50933 WP_011230813.1.59104 WP_011230813.1.60903 WP_011230813.1.6497 WP_011230813.1.70239 WP_011230813.1.77642 WP_011230813.1.78869 WP_011230813.1.80994 WP_011230813.1.8599 WP_011230813.1.90668 WP_011230813.1.91533 WP_011230813.1.93593 gi|448237469|ref|YP_007401527.1| gi|319766336|ref|YP_004131837.1| 235909.GK1314 544556.GYMC61_2104 gi|297530510|ref|YP_003671785.1| gi|375008292|ref|YP_004981925.1| gi|261419520|ref|YP_003253202.1| gi|56419849|ref|YP_147167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]