SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419913|ref|YP_147231.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419913|ref|YP_147231.1|
Domain Number 1 Region: 145-188,230-398
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.65e-17
Family Extended AAA-ATPase domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56419913|ref|YP_147231.1|
Sequence length 559
Comment hypothetical protein GK1378 [Geobacillus kaustophilus HTA426]
Sequence
MSLHDLFRQVMAIYEQEKREKLSKERRSFQLVTRAIPEALKTLPFLPPDRYVVKGSVGQG
VWTDVPWVAVMDQEVTDSTQRGYYIVYLFSEDMRRLYLTLAQGVTETPRDEMERVKRGIR
QLIPAEERVRTNDDIRLGESKRAKDYERSVAAYIAYSFDDLPSNEQLARDLETMIGYYRQ
YVERTEPMAPPEQALSYREAVEHIHSYISAKGFYYTKEEVTNLFLSLKTKPFVILSGISG
TGKTKIVQWLAESVGATEDNGRFTLIPVRPDWHDGSDLLGYVDIKGDFKPGPLTNVIIEA
GKHPDKPYFVVLDEMNLARVEHYFSDVLSVMESRRWEDGRITSSRLLPRETAGCDLFLPP
NVYIIGTVNMDETTHPFSKKVLDRANTIEFNRVRLDHLDFLRDLPTVAPLSVGQELFAAR
YLHLKDVYARCPELVETVTKQLVEINRILAPLGAHIGYRVRDEICFYLAYNEEGKLMEFD
KAFDYCLMQKILPRLSGSDVRLETALKQLFVLCAVFEPDGDYSGVLDVSYARYPKSAEKI
WQMLRRLEDDGFTSFWLGA
Download sequence
Identical sequences A0A1V9BSX1 Q5L073
235909.GK1378 WP_011230875.1.2219 WP_011230875.1.70239 gi|56419913|ref|YP_147231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]