SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419917|ref|YP_147235.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419917|ref|YP_147235.1|
Domain Number 1 Region: 224-480
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.27e-25
Family Tandem AAA-ATPase domain 0.028
Further Details:      
 
Domain Number 2 Region: 398-454,511-561,588-668
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000198
Family Tandem AAA-ATPase domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56419917|ref|YP_147235.1|
Sequence length 1021
Comment type I restriction-modification system specificity protein [Geobacillus kaustophilus HTA426]
Sequence
MATRPLGETEFEETTIERLKRLGYDYLHAQELFQRGERDSLHEVVLYGRLEAFLKKAYPA
IPEHEIKRLAQVLTAPDGVKLINRNMHFHQMLTKGLEFSYEVNDETYTPHVFPIDWEHPE
NNDFLVVNQLSIEGRMSRRPDIVIYINGLPLIVFELKNPNNEQATVYDAYTQIQNYTYDI
SQLFNYNAFTVISDNVETKHGMPFADYDFFASWKSIDGRNVDNNRANTMRTLIEGLFPKD
RLLNYIRNFIVFLEEGSKITKIGAKYHQFFGVNFAVNEAIRATRPDGDRKIGVMYHTTGS
GKSLSMLFFAGILSRHPEMENPSIVIQVDRNDLDEQLHDTFVQGKSYIGHVHHAENTEQL
RTLLRGEAGQIIFSTIEKFRKKEGETRHPVLSERRNIVVIADEAHRTQAGFAGGFAAQLR
YALPNASYIGFTGTPVDFVDNNTEEIFGHIIHRYDMAQAVEDKATLPIYYESRLIPLDLS
AGDIDEKYKKIIEEAGGDDEESETYKRKWAALEKVVGTPKRLRRLAKDIVSHFNQVANPF
QKAMIVCMSRRIAVDLYNYLREIPECPPVEVIMTGDVSKDPKEWREVQPGSKYAHIKSKK
EQEEVKAKLRDPEDPLKFVIVVDMWLTGMDAKPLSYLYVDKPMKGHNLMQAIARVNRVFP
GKEGGVVVDYIGIATSLKEATHKYTQSGGTGSPTYDISEAVSIFMEHLEAVRGFIPSDID
VQNWRAKPKIEREDFIADLVNILLNRDPEEYIQAAAKLEKSYQLVKHQPEVLELADEVML
YFMMKAQLRKHLHPSTGGSKENKTLEERLSELIDNSLLAKETVDIFQIAGIERPDISILD
EAFLADLTKKEHVDLRLKLLKKLLEDQIKVTFSQGSPQSKALSELLEKTLRDYHNRVIQA
ADVVRVMINMRKEMEEEIRRRHDLGLSEEEIEFYKAITAMEQEAFSNEFLASLIHKVVNA
LKKQLAVDWTSPHRRDVYAKVKLAVKQVLMKEKITGQQLQFLTNKFMEQAERQYKNWPMN
A
Download sequence
Identical sequences Q5L069
gi|56419917|ref|YP_147235.1| WP_011230879.1.2219 235909.GK1382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]