SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419945|ref|YP_147263.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419945|ref|YP_147263.1|
Domain Number 1 Region: 146-346
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.95e-64
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000381
Further Details:      
 
Domain Number 2 Region: 431-563
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000688
Further Details:      
 
Domain Number 3 Region: 13-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.29e-32
Family Duplicated SiR/NiR-like domains 1 and 3 0.0023
Further Details:      
 
Domain Number 4 Region: 348-424
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.49e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419945|ref|YP_147263.1|
Sequence length 573
Comment sulfite reductase subunit beta [Geobacillus kaustophilus HTA426]
Sequence
MAKVELKAPDGPPSDVERIKQESRYLRGTLAETMEDPLSAGIPDDDNRLMKFHGSYLQDD
RDVRTERQKQKLEPTYQFMIRVRTPGGVATPEQWLVMDELARKYANGTLKLTTRQAFQLH
GVLKWNVKKTMQAINGALMTTLAACGDVNRNVMCNPNPYQSEVHAEVYEWAKLISDHLLP
RTRAYYEIWLDDEKVAGTPPVDGEEEPIYGPTYLPRKFKIGIAVPPSNDVDVFSQDIGFI
AIVEDGKLAGFNVAIGGGMGMTHGDKTTYPQLAKVIGFCKPDQVVEVAEKIMTVQRDYGN
RSSRKHARFKYTIDRLGLEAVKEEIERRLGWRLGEARPYHFEHSGDRYGWVEGVNGTWHF
TLFVEGGRVKDYDDYKLMTGLREIAKVHTGDFRLTPNQNLIIANVTSEKKPEIEALIAKY
GLTDGRRYTALRRNALACVALPTCGLAMAEAERYLPKLLDKIEEIIDENGLRDEEITIRM
TGCPNGCARHVLAEIAFVGKAVGKYNMYLGAAFNGTRLGKLYRENIGEEEILRELRMLLS
RYAKERLDGEHFGDFVIRAGIVKEVTDGTNFHD
Download sequence
Identical sequences A0A1V9BU21 Q5L041
235909.GK1410 WP_011230906.1.2219 WP_011230906.1.70239 gi|56419945|ref|YP_147263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]