SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419950|ref|YP_147268.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419950|ref|YP_147268.1|
Domain Number 1 Region: 786-1214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-44
Family Tandem AAA-ATPase domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56419950|ref|YP_147268.1|
Sequence length 1255
Comment hypothetical protein GK1415 [Geobacillus kaustophilus HTA426]
Sequence
MLYVSPAKIASYFYHECERNFYFQSLAKERRSELDVPEELFERPAVHQSVLRRGVEWEEE
VITTYLAGRVQMGKREPGAPISHCYLDGEETIRELKQPSKRYLYQPTLIAPPRFYERYGL
DLKVIRFAACRPDLIECIPGQNGFVFRIIDIKSSDVLKLSHRVQTALYALMLSSVLEEHG
VKGSVDLREAGIWTYKTEQPQLTDIGQLLPFLEQFLASELTALAEKQPDELFWHLDYRCE
WCPFYDYCFDKARKQSHISLVPYLSSHASRFIRERQLPETIGEFRQLLERQETRHVLKQN
AGLARQLGRLEAQLEAIAEEKVVPYDQAVTHMPIWEDIRLILTAQRDPLTGKIAAASLYR
VGGTDVFGTGSEMHHVIAGSLEECDAVGRTFADALDRLLQTVHDYNRDREWRSQKSVQAY
VTDNYEWDNVQQLLQALLFDPDYNEKAVRLLSYFHSSSLASVNDHPDEIVPLPVVVLTTA
VSQLFALPTHVAYRLEDLSRYIAAYHDSPFLYSASERFSFRLTNAMKLDVLHDAWQTGDT
ETRQAVEKELSRRLWAAHSIIQGIRAWAESVDPSPLMVWPEKFAFPHSADYRDPLVSKLA
FMARYEALLNYLEIRRSRLLPLSERLENGVTLHVTYLGGDRFRLNNRQALETIDLKASWL
LTECNEEGEKAQQTFPDYKYSSEWKPPQWANLYFTRIRAIEDDGKTAELELELPKWIDRF
PLVEGEEYRLSIRHADFTTPRVLQALQQLDQENHRILDLIRDPIRYRKTFRPNWDAEEVK
ALLRRSGLTKSQRQAFLQFLRHTLTLVWGPPGTGKTHFIAVALRLLMEMYEKRGRRLAIL
VSGFTHAAIENVLRKIQELAPRRSVHIAKLGEIQTENAKGIAEVADRDLPRWLGNGGHRV
LGATLYGIQRAYEKDCLEEFDVVILDEASQIRVADSLLAQRHVKKAGRLLIVGDHFQLPP
IIQGAYAAAEGEPHLFDSIFRLLFDADVEKRYTRQLTDNFRMNEALCRYPADRIYGRDYT
AFNRQIAEQTLALVDAPTADEWVEAAIDPDYPLVVCVYDGAHGTQENEAEARWVANITRV
LRERLLDGDGKRYDDTPDGDQAFWRHGLFIISPHRAQIRAIRRELERQELRPPFFVDTVD
KMQGQEADAAIISYGVADPELAVMEGEFIYSLNRLNVSLTRARKKTILFLSRQLMSPSLQ
VIGNEEYREGVNFMLGLEHYASRRGEARAFMIDGVKLYMYRVGCSKLEKVDHSSL
Download sequence
Identical sequences A0A098L4L2 A0A1C3D3H1 Q5L036
gi|56419950|ref|YP_147268.1| 235909.GK1415 WP_011230911.1.2219 WP_011230911.1.22479 WP_011230911.1.78869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]