SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56419996|ref|YP_147314.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56419996|ref|YP_147314.1|
Domain Number 1 Region: 4-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-62
Family ABC transporter ATPase domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56419996|ref|YP_147314.1|
Sequence length 270
Comment iron(III) dicitrate ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MHGLQAKELTLSYGEAIVIDRLDLTIPKGKITVFIGANGCGKSTLLRALARLLKPTSGAV
LLDGKEIAKQPTKEIARRLAILPQSPMAPEGLTVLQLVKQGRYPYQTWFKQWSDEDERAV
VRALEATGLAEFAERPVDSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDLAHQIDILD
LLFELNEKERRTIVMVLHDLNLACRYAHHLVAIRDKTVYAEGKPEDVISRQLVKDVFQMD
CQITYDPIFGTPLCIPYGKGRRILQKEGVS
Download sequence
Identical sequences A0A1C3D3L4 A0A1V9BWW9 A0A2H5KER1 G8N3Y9 Q5KZZ0 T0NY91 U2Y4M0 V6VHI9
gi|56419996|ref|YP_147314.1| 235909.GK1461 WP_011230957.1.100150 WP_011230957.1.2219 WP_011230957.1.22479 WP_011230957.1.25743 WP_011230957.1.45808 WP_011230957.1.60903 WP_011230957.1.70239 WP_011230957.1.78869 WP_011230957.1.8599 WP_011230957.1.90668 WP_011230957.1.91533 WP_011230957.1.93593 gi|375008482|ref|YP_004982115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]