SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420018|ref|YP_147336.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420018|ref|YP_147336.1|
Domain Number 1 Region: 6-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.22e-42
Family G proteins 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56420018|ref|YP_147336.1|
Sequence length 244
Comment hypothetical protein GK1483 [Geobacillus kaustophilus HTA426]
Sequence
MTDMTYTIALMGNPNTGKSTLFNVLTGLRQHTGNWPGKTVTHAEGECRHRGTLYRIVDLP
GTYSLYSNSADEEVARDFLLFQRPDVTVVVVDATALERNLNLALQVLEMTDRVIIAINLM
DEAKKKGIHINTKKLAVKLGVPVVPISARNREGIDALLDTVDAMAHGRINTNPLSIRYSP
EIERGIAKLLPLVKDVMGDTYPARWIALRLLDGDTSLLQALKQPPQPLIKEGNAYACCGS
IKSI
Download sequence
Identical sequences A0A063YVA0 A0A1C3D3M5 A0A1V9BX71 Q5KZW8 V6VCV1
WP_011230979.1.19233 WP_011230979.1.2219 WP_011230979.1.22479 WP_011230979.1.25743 WP_011230979.1.45808 WP_011230979.1.60903 WP_011230979.1.70239 WP_011230979.1.90668 235909.GK1483 gi|56420018|ref|YP_147336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]