SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420022|ref|YP_147340.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420022|ref|YP_147340.1|
Domain Number 1 Region: 35-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-57
Family ABC transporter ATPase domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56420022|ref|YP_147340.1|
Sequence length 323
Comment hypothetical protein GK1487 [Geobacillus kaustophilus HTA426]
Sequence
MIRVSHLHKSFRVHRREAGWLEAARSLWRRDYRVIEAVKDVSFTIEKGEIVGFLGPNGAG
KTTTMKMLAGLLHPTSGEITVGGFVPFEQKPEFKKMMSLVMGQKSQLIWDIPPMETFLVN
KAIYDIDDRAFRQTLEELTELLDLAPLLDKPTRSLSLGQRMRCELAAALLHRPQVLFLDE
PTIGLDVHTQENVRRFIVDYNREHETTILLTSHYMGDVAALCDRVMIINYGRLIYDGELS
VLTEKLAPYKRLEVRFSRVPDMDWGEYGEVAEIEEGTVVLRVAREKAAGTAARLLERFDV
RDINIEDPPLEEVITRAFQEERV
Download sequence
Identical sequences A0A063YTF5 A0A1D7NB57 A0A1V4P8R7 A0A1V9BX20 Q5KZW4
235909.GK1487 gi|56420022|ref|YP_147340.1| WP_011230983.1.19233 WP_011230983.1.20723 WP_011230983.1.2219 WP_011230983.1.25743 WP_011230983.1.3446 WP_011230983.1.60903 WP_011230983.1.6497 WP_011230983.1.70239 WP_011230983.1.78869 WP_011230983.1.8599 WP_011230983.1.90668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]