SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420072|ref|YP_147390.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420072|ref|YP_147390.1|
Domain Number 1 Region: 16-241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.73e-44
Family Tandem AAA-ATPase domain 0.0027
Further Details:      
 
Domain Number 2 Region: 69-124,305-445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.8e-34
Family Tandem AAA-ATPase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56420072|ref|YP_147390.1|
Sequence length 758
Comment ATP-dependent RNA helicase [Geobacillus kaustophilus HTA426]
Sequence
MKKQTLSEWIEQLRQDPNVVHWHEIEPKEANFVPFPDELDPRLGAALKARGIASLYTHQA
AAYDAVQSGRNIVAVTPTASGKTLCYNLPVLDAIAKEPSSRALYIFPTKALAQDQKNELN
EIIAEMGVSIYSHTYDGDTAPALRQKIRQAGHIVITNPDMLHTAILPHHTKWISLFEQLR
YVVIDELHTYRGVFGSHVANVIRRLKRICAFYGSRPTFICTSATIANPKELAERLIGEPV
ALIDNNGAPRGRKYFVFYNPPVVERTMNIRQSATKTAVELARQLLVNRIPTIVFARSRVR
VELILSHLQAVVNERIGDTTIRGYRGGYLPNERRAIEKGLRSGEIIGVVSTNALELGVDI
GQLQACILTGYPGTIASTWQQAGRAGRRQGDSLVVMIASASPLDQYIISHPEYFFARSPE
AARINPDNLLILVDHIKCAAYELPFRRGETFGGVEVEEVLDFLAEQGVLNERAGRWHWMS
DAFPAHDISLRSAAQENVVIIDISDTAHHRVIGEMDRFSAMTLLHDEAIYLHEGAQYQVE
KLDWEEKKAYVRQVDVEYFTDANLAVRLDVLSEDRSETRGQMAVRYGDVSVRAMATIFKK
LKLSTFENIGSGPIRLPEETLHTSAAWIEWEAVPSRFSPALFEQLLVGIANVLGHLVPVF
VMCDRSDLHVVPQLKAPHSGRPTIFLYDRYPGGVGLSEAVFERYEEIMKHVKEWVERCPC
ADGCPSCIGISSADGPSLKRELVQFLDEQLAVWAGPSV
Download sequence
Identical sequences A0A098L493 A0A1C3D1K2 Q5KZR4
gi|56420072|ref|YP_147390.1| WP_011231033.1.2219 WP_011231033.1.22479 WP_011231033.1.60903 WP_011231033.1.6497 WP_011231033.1.78869 WP_011231033.1.91533 235909.GK1537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]