SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420088|ref|YP_147406.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420088|ref|YP_147406.1|
Domain Number 1 Region: 45-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.06e-33
Family G proteins 0.027
Further Details:      
 
Domain Number 2 Region: 655-721,788-934
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-30
Family G proteins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56420088|ref|YP_147406.1|
Sequence length 1263
Comment hypothetical protein GK1553 [Geobacillus kaustophilus HTA426]
Sequence
MNVNDIEGDKGVLVMGHIAIERPSLRLWLSKMIDMHDQLQSADDQEHADKVKQLIEKAAS
GELIVAFCGHFSAGKSSLINALLGEPMLPSSPIPTSANLVKVKAGPDYVRVFFHRDEPVE
YEPPYDPDLIRAQCRDGETIEWIEISRTTDAIPPGVAILDTPGIDSTDDAHRLATESALH
LADVVFYVMDYNHVQAELNFQFTKQLTDEGKTVYLIINQIDKHRDDELPFAEFRASAAEA
FRRWGVEAARLFFLSLKDPSHPHNEWHELVACLRRLFADKEEWLVRGAESALKRIADGHL
EHLRARHELLEQTIETRLEALGGADDEAAAIAELDRLEAELADWQTAPSRAEEAFRSELE
RVLQNAYVMPFETRERAEAYLQAMQPNFKVGLLFAKTKTEQERKRRLEAFYESVKAQAAA
QIEWHVRQLLVQFGKEWHADDDWFSECQQWTAEWDETMLAGLVKQGAESSGAALLNYTDE
VAAALKKRYRDSALALFAELKEQIAKRAAAQTETLNGQLSAAREKVELAARLARLRAERD
ERRRAFEQLIAAPCESASLDENRLAALTAPPVFRKARHAETAKPQAASKPAETSHLSVKE
QALGQEAAGLGVSERADEARTLSSGRKQRSEEAAERLEEAAAWLERSELLGRFAGPLRDK
ARRLRERSFTVALFGAFSAGKSSLANALLGAPLLPSSPNPTTAAISKIAPPDHKHPHGTA
VVKVKSELQIWADVQSSLRQCGHEADTWDEALRLCARLAESGAEHPAQKPHVAFLAAAAA
GYERMNGRFGEIVSIGWEELETYVADEAVSCFLDEVVLYADCPLTCQGVTLVDTPGVDSL
NARHTGVAFHYMKHADALLFVTYYNHAFSKADREFLLQLGRVKDTFALDKMFFVINAADL
AQSKEELEAVISYMNGELARFGIRFPRLYALSSRLALAEKTGAEPGPRGVLADSGLSAFE
TDFFRFLTEELAEVAVESAYAELERARRAAEEFARAAGQSEAEKAEKRQALEAVKTKMHA
VLAGIDDAYGRQALRQEVDELLYYVKQRVFFRLNDVFKEAFNPAVLRDDQGPARRALERC
LDELLASVGFDLAQELRATSLRVESFLHKQLAEQFSRLFHELRRFDDALALTPPEPFAFS
APEFANALGDVDRVRFTKALSLYKNAKSFFERDEKRRMKEEIEAALVEPIDAYLAEQKER
LVATYAEQYKAAVAALSAALAEQVDSYMEGLLAALAEAADHEALARIEAALRGLLSGRVG
EAR
Download sequence
Identical sequences A0A098L2S4 G8N4N7 Q5KZP8
gi|375008568|ref|YP_004982201.1| gi|56420088|ref|YP_147406.1| 235909.GK1553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]